(data stored in ACNUC7421 zone)

EMBL: CP002116.PE243

CP002116.PE243       Location/Qualifiers
FT   CDS_pept        complement(252373..253653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0247"
FT                   /product="protein of unknown function DUF401"
FT                   /note="COGs: COG1906 conserved hypothetical protein;
FT                   InterPro IPR007294; KEGG: dol:Dole_1082 hypothetical
FT                   protein; PFAM: protein of unknown function DUF401; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF401); TIGRFAM: converved hypothetical integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79403"
FT                   /db_xref="GOA:E1RAB2"
FT                   /db_xref="InterPro:IPR007294"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB2"
FT                   /protein_id="ADK79403.1"
FT                   /translation="MTIPLMLKIILSLALILVLNKIVRNLAISVAAGALLIAFWSGQTI
FT                   VTAGVIASKRMLSFDNFALLLLIALVITLSNQMNQTGMMKQLVGGLKARVSQKEALAAL
FT                   PAVIGLLPMPGGALFSAPLLDDCDDRGELSPMQKTKINYWFRHVWEFTWPLYPGVILAS
FT                   DIAHVEVWQIFFLGLPLSLVSITVGYLFYLRPLKLTAERRESNSKSNGPSLVSLLAPIM
FT                   IVVVIYFLIMVFLPAVGTLSKYLPMIIGLLSSILYLQIISPLTRKEWKKIALSHRTLQM
FT                   VLIVLVVRVYGAFIEAPLPNGILLMEQLRLELTAAGVPLRLLVLLIPFISGMTTGVSVG
FT                   FVGACFPIVFSLLGPSPTLASTLSTLALAYPFGFMGTMMSPVHVCLIVTNEHYGTNLGP
FT                   SIGAVIPPAIFVMAGSLLISYIVPFIV"
     atgaccatac cacttatgct taagattatc ctttcgcttg ccttgattct tgtcctcaat        60
     aagatcgttc ggaaccttgc catatcggtt gccgccggtg ccctcctcat cgctttctgg       120
     agcggccaga ccatcgtaac ggcaggagtc attgcaagca aacgaatgct cagttttgac       180
     aattttgccc ttttgcttct gatcgcattg gtcatcactc tttcgaatca gatgaaccaa       240
     accggaatga tgaagcagct ggtaggaggt cttaaggccc gggtaagtca gaaagaggct       300
     ttggcggctt tacctgcggt gataggactt ctacccatgc ctggaggcgc cctcttttcc       360
     gctccgcttc tcgacgactg cgacgacagg ggagaactga gcccgatgca aaaaacaaag       420
     atcaactatt ggtttcgcca cgtgtgggag ttcacctggc ccctctatcc cggggttatc       480
     ctagcctccg atatagcaca tgttgaagta tggcagatct tttttcttgg tttgccgctc       540
     tcgttggtat cgatcacggt aggatatctg ttctatctgc gtcctctcaa gctcacggca       600
     gaaagaagag agagcaacag taaaagcaac ggcccatcgc tcgtatctct actcgcaccc       660
     attatgatcg ttgtggtaat ctatttcctg ataatggttt ttctcccggc agtgggaacc       720
     ctctctaagt atctccccat gatcatcgga ttgctctcct caatactcta cctgcagatc       780
     atctctccgt tgacgcggaa ggagtggaaa aagattgcat tgagccacag gaccttacaa       840
     atggttctca ttgtattggt ggtacgagtc tacggggcat tcatcgaggc accgctgccg       900
     aacgggatct tgctgatgga acaacttcgg ctggagctca ccgcggcagg agtgcccctt       960
     cgtctacttg tccttctcat accctttatc agcggcatga cgacaggggt ctccgtgggg      1020
     tttgtcggcg catgctttcc catcgttttt agcctcctcg gcccctctcc cacgcttgct      1080
     tcgaccctct caaccctggc ccttgcctat ccctttggtt tcatgggaac catgatgagc      1140
     ccggtccacg tctgtctcat tgtcacaaat gaacactacg gaacaaacct cggcccaagt      1200
     atcggcgcag taattccacc ggcaattttc gttatggccg gaagtttact gatctcctac      1260
     atcgttccgt ttatagtata g                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page