(data stored in ACNUC7421 zone)

EMBL: CP002116.PE244

CP002116.PE244       Location/Qualifiers
FT   CDS_pept        253778..254299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0248"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="COGs: COG0735 Fe2+/Zn2+ uptake regulation protein;
FT                   InterPro IPR002481; KEGG: tye:THEYE_A1865 ferric uptake
FT                   regulation protein; PFAM: ferric-uptake regulator; SPTR:
FT                   Ferric uptake regulation protein; PFAM: Ferric uptake
FT                   regulator family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79404"
FT                   /db_xref="GOA:E1RAB3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB3"
FT                   /protein_id="ADK79404.1"
FT                   /translation="MDYSSRGYGRGFGRGCSRAEGPFQRKGVRMTLTRRVIIEALDRAD
FT                   GYLSAEELFLIVREEYPGIGVATIYRTLQLLEELALVQRVETGEGRARYAMSRDKDAGE
FT                   AGVGNEVVLICDRCGKVIRQPKAAARCSELFDSLSRKAEENYRFHTERQVLQIHGLCAG
FT                   CTGAPSEKSR"
     atggattatt ccagtcgtgg atatggaaga ggattcggca ggggctgttc ccgtgccgag        60
     gggccgtttc aacggaaagg ggtacgaatg acattgacac gtcgggtcat catcgaggcc       120
     cttgatcgtg ccgatggtta cctttctgcc gaagagctct ttctcatcgt acgcgaagaa       180
     tacccgggaa tcggggtcgc caccatctac cgaaccctgc agctccttga agagctcgct       240
     cttgtccagc gagtagagac gggggagggg cgcgcgcgat atgccatgag ccgtgataaa       300
     gatgcgggag aggctggtgt cggcaacgag gtggtattga tttgcgaccg atgcggaaag       360
     gttatccggc agccgaaagc ggccgctcgc tgctctgaac ttttcgattc tttgagtcgg       420
     aaagcggaag agaactatcg ctttcacacc gaacggcagg ttttgcaaat ccacgggctt       480
     tgtgcgggat gcacgggtgc gccttcggag aaaagccgat ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page