(data stored in ACNUC7421 zone)

EMBL: CP002116.PE245

CP002116.PE245       Location/Qualifiers
FT   CDS_pept        254379..254678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tit:Thit_1682 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79405"
FT                   /db_xref="InterPro:IPR035205"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB4"
FT                   /protein_id="ADK79405.1"
FT                   /translation="MPGRDGRGPIGYGPQTGRGLGMCGGGYGLGSGFGRGGYGRGGCGY
FT                   GAYGRGGYAYPHPVSKEEREAGLAARELALEEELKWIRSMRTEEGEGANKGAEA"
     atgccaggaa gagacggacg aggacctatt ggttatggtc cacaaacagg acgcggattg        60
     ggaatgtgcg gaggaggcta cggcctaggc agtggctttg gtcgtggagg ctacggccga       120
     ggaggatgcg gttacggtgc ctatggccgc gggggatatg cttacccgca tcctgtttcg       180
     aaagaggaac gagaggctgg tcttgcagcc agggaattag ccttggaaga ggagctaaaa       240
     tggattcgca gcatgcgaac cgaagaaggt gaaggggcga ataagggggc cgaagcatga       300
//

If you have problems or comments...

PBIL Back to PBIL home page