(data stored in ACNUC7421 zone)

EMBL: CP002116.PE246

CP002116.PE246       Location/Qualifiers
FT   CDS_pept        254675..255043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0250"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="COGs: COG1433 conserved hypothetical protein;
FT                   InterPro IPR003731; KEGG: mla:Mlab_1056 hypothetical
FT                   protein; PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; SPTR: Dinitrogenase iron-molybdenum
FT                   cofactor biosynthesis protein; PFAM: Dinitrogenase
FT                   iron-molybdenum cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79406"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB5"
FT                   /protein_id="ADK79406.1"
FT                   /translation="MKVAVAADGTMVSGHFGHCEQFVVADIANGRVESTTPVANPGHTP
FT                   GALPPFVASLGASKIVAGGMGPRAIELFEANGVGCILGISGPISDALEKLAKGELEGGE
FT                   SSCTGSHDHDCDHEEGRI"
     atgaaggttg ctgttgccgc tgatggaacc atggtctccg gccattttgg tcactgtgaa        60
     caatttgtag tggccgatat tgcaaacggg agggtggaat cgaccacacc ggttgcaaat       120
     cccggacata ctcccggagc tctcccgccc tttgtcgctt cacttggggc ttccaagatt       180
     gttgccggcg gtatgggacc tcgggccatc gagctttttg aggcaaacgg ggttggttgt       240
     atcctcggta tttcgggccc tatttccgat gcactggaaa aacttgcaaa gggtgaactt       300
     gaaggtgggg agagtagctg taccggtagc catgatcacg attgcgacca tgaagagggg       360
     aggatctga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page