(data stored in ACNUC7421 zone)

EMBL: CP002116.PE247

CP002116.PE247       Location/Qualifiers
FT   CDS_pept        255047..255403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0251"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="COGs: COG1433 conserved hypothetical protein;
FT                   InterPro IPR003731; KEGG: mma:MM_0988 hypothetical protein;
FT                   PFAM: Dinitrogenase iron-molybdenum cofactor biosynthesis
FT                   protein; SPTR: Conserved protein; PFAM: Dinitrogenase
FT                   iron-molybdenum cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79407"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB6"
FT                   /protein_id="ADK79407.1"
FT                   /translation="MIICITASGREESSQQDPRFGRCEAFYLFDDTKKEGRFIDNPFKN
FT                   AVGGAGVRAAELIVKEGASRLVSGQIGPNAWDVLKEAGIRVFSSKEANIRAALEAFLAG
FT                   NLSEVEAPGPAGHK"
     ttgattatct gtatcacagc atcaggacga gaagagtcgt cgcaacagga tccccgcttc        60
     ggccgatgcg aggcgtttta tctctttgat gatacgaaga aagaggggcg ttttatcgat       120
     aaccccttta agaacgcagt cgggggagcc ggtgtacgag ccgccgagct cattgtaaaa       180
     gagggggcca gtcgccttgt ttcaggacag atcgggccca atgcctggga tgtcctgaaa       240
     gaggccggta ttcgtgtctt cagttccaag gaggcaaata ttcgagccgc tcttgaggcc       300
     tttctcgcgg gaaatctttc tgaagtcgag gctccggggc cggcgggaca taaatga          357
//

If you have problems or comments...

PBIL Back to PBIL home page