(data stored in ACNUC7421 zone)

EMBL: CP002116.PE248

CP002116.PE248       Location/Qualifiers
FT   CDS_pept        255400..256272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0252"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="COGs: COG1149 MinD superfamily P-loop ATPase
FT                   containing an inserted ferredoxin domain; InterPro
FT                   IPR002586:IPR001450:IPR017896:IPR017900; KEGG: pth:PTH_0584
FT                   MinD family ATPase; PFAM: Cobyrinic acid ac-diamide
FT                   synthase; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; SPTR: Cobyrinic acid a,c-diamide synthase; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain; 4Fe-4S
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79408"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB7"
FT                   /protein_id="ADK79408.1"
FT                   /translation="MTITVASGKGGTGKTTIATALAMLWPEPVALLDADVEEPNCRFFL
FT                   DTTEGKQREVFLPVPQIDEAICTGCGACSSFCRYGALVRIGKKVMTFPNLCHSCGACMM
FT                   VCPEGAISEKPSFIGTIDSAQFRALDGSLRTHRWGTLKLGAAMAPPLIRELRREKDKEP
FT                   LQLIDSPPGASCPMANAVKNADLVLMVAENTPFGAHDLEKAISTLEEMDLPVLALINRA
FT                   DLGGGEAEAVCRRKGIDIIGRVPFDRKVAESYARGVHPILEVPAFRQAVEQVVGHLIAF
FT                   LQTSIEQKT"
     atgaccataa cggttgccag cggaaaggga ggaacgggaa aaaccacgat tgcaacggcc        60
     ctggccatgc tttggccgga gcctgttgca ttgcttgatg ccgatgtaga ggaacccaat       120
     tgccgttttt ttctcgatac aacggaggga aagcagcggg aggttttcct ccccgtccct       180
     caaattgatg aggcgatctg taccggctgc ggtgcctgca gtagtttttg ccgctatggt       240
     gctttggtaa gaataggcaa aaaggtcatg acctttccta atctttgcca cagctgcgga       300
     gcctgtatga tggtctgtcc cgaaggggcc atcagcgaaa aaccctcttt catcggcacc       360
     atagattcgg cccagttccg agctttagac ggcagccttc gtacccatcg ttgggggacc       420
     ttgaagctgg gagctgctat ggctcctccg ctcatcaggg agctgcgcag ggaaaaagac       480
     aaagagcctc ttcagctgat cgattcgccg ccgggggcca gttgtccgat ggcaaatgct       540
     gttaaaaatg cagatctcgt acttatggtc gcggaaaata ccccctttgg cgcacatgat       600
     ttggagaagg ccatttcgac cctcgaagag atggacctcc cggtcctggc tcttatcaac       660
     cgggccgacc tgggcggagg agaggccgaa gcggtatgcc ggcggaaagg tattgatatc       720
     attggccgtg ttccctttga ccgaaaggtt gccgaatcct atgcccgtgg agtacatccg       780
     atccttgagg tccctgcctt tcgtcaggcg gtagaacagg tcgttggcca tcttatcgct       840
     tttttacaaa ccagtatcga gcaaaaaaca tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page