(data stored in ACNUC7421 zone)

EMBL: CP002116.PE249

CP002116.PE249       Location/Qualifiers
FT   CDS_pept        256269..257195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0253"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="COGs: COG1149 MinD superfamily P-loop ATPase
FT                   containing an inserted ferredoxin domain; InterPro
FT                   IPR002586:IPR001450:IPR017896:IPR017900; KEGG:
FT                   mta:Moth_1408 cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: Cobyrinic acid
FT                   a,c-diamide synthase; PFAM: CobQ/CobB/MinD/ParA nucleotide
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79409"
FT                   /db_xref="GOA:E1RAB8"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB8"
FT                   /protein_id="ADK79409.1"
FT                   /translation="MKHEKAKRIVVISGKGGTGKTFFTSAIASLVSGRSVFADCDVDAA
FT                   NLALALGGAAPAASRRQERFFGGERAVVDAGLCTGCGKCISFCRFDAIHMENSVAQVDP
FT                   VGCEGCGVCTLVCPSSAFTLEEEMAGQWFVTDTQDGPLIHAELQAGGENSGKLVHKVRS
FT                   VAEQEAERVGASLILIDGPPGTGCPVLAAASDTDAILLVTEATTTALHDLERAAEVAST
FT                   FGTPIGVLVNKSDLNPEVVKKARILCDEKGYRWIGDFPYDRMAAEASARLLDPFSLLED
FT                   TTADKLRALVANALNMVGLDVVSSAVG"
     atgaaacatg aaaaagcaaa acgcatagtt gtcatcagtg ggaagggagg aaccggaaag        60
     acctttttta cttcggctat cgcttctctc gtttccggaa gaagtgtttt tgccgactgc       120
     gacgtggacg cagcgaatct tgctcttgcc cttggaggag ctgctccggc agcctcaagg       180
     aggcaggaac gcttcttcgg tggagagcgt gcagtggttg atgccgggct ctgtaccggt       240
     tgcggcaagt gcatttcatt ttgcagattt gatgccatac acatggagaa ttctgtggcg       300
     caggtggatc ctgtcggttg tgaaggttgc ggagtgtgca cccttgtctg ccccagttcg       360
     gcttttactc tggaggagga gatggccggg cagtggtttg tcaccgatac ccaggatggc       420
     ccgcttattc acgctgaatt acaagccggt ggcgagaatt caggcaaatt ggtccacaag       480
     gtaagaagtg tcgcagaaca ggaagccgaa cgggtcggcg cttcgcttat tctgatcgac       540
     ggccctccgg ggaccggctg tcctgtactt gccgccgcct cggatacgga tgcgatacta       600
     ctcgttaccg aggcaactac cacggcgctt cacgaccttg agcgggcagc tgaggttgca       660
     agcactttcg gaacccccat aggtgttctt gtaaacaaaa gcgaccttaa tcctgaggtt       720
     gtaaagaaag cccggattct gtgtgatgag aaagggtacc gctggattgg tgatttcccc       780
     tacgaccgca tggctgcaga ggcttcggct cgtcttctcg atcccttttc gcttctggag       840
     gatacgacgg ccgataaact tcgtgcactg gttgcaaatg cgctcaacat ggtcggtctt       900
     gatgtggtat catcagcggt cggttga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page