(data stored in ACNUC7421 zone)

EMBL: CP002116.PE25

CP002116.PE25        Location/Qualifiers
FT   CDS_pept        21403..22392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0025"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: fnu:FN0397 peptide ABC transporter permease; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Putative uncharacterized protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79185"
FT                   /db_xref="GOA:E1R6Q3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q3"
FT                   /protein_id="ADK79185.1"
FT                   /translation="MWKYILKRLLMMIPVLIGVTFIVFFIMALTPGDPAAIILGDQASA
FT                   EALALKRIELGLDKPIPIRYLNYVNDMFHGDLGTSYKNQIKVWDQVWDKFPNTAILAVA
FT                   GILVALLIGIPIGILSAKKQYTFMDNSSMVLSLIGVSMPNFWLGLLLSLFFALKLGWLP
FT                   SQGMGTGFFPLLRSLVLPAITLGTGAAATVVRMTRSSMLEVIRQDYISTARAKGLSEKA
FT                   VTRHHMLKNAMIPIVTAVGLQFGQLLGGAMLTETIFSWPGLGRLMVDSITSKDIPMVLG
FT                   AVIFMAVMFSFVNLLVDIIYAFIDPRIKSQYDKAGVKRIGFRKRSIAA"
     atgtggaaat atatcctcaa acgactcttg atgatgattc ctgtgctcat cggtgtgacc        60
     tttattgtat tttttatcat ggcactgact ccaggcgatc ctgctgcaat tatccttggt       120
     gatcaggcta gtgccgaggc tcttgccctg aagcggatcg aacttggact cgataaaccc       180
     ataccgatac gttacctcaa ctacgtaaat gatatgtttc atggggatct aggtacctca       240
     tacaaaaacc aaatcaaggt ctgggatcag gtgtgggata agtttcccaa caccgctatc       300
     cttgccgttg ccggtatttt ggttgccctc ttgattggaa ttccgattgg tatcctctct       360
     gcaaagaagc aatatacctt catggacaac tcctcgatgg tgctttccct cataggtgtg       420
     tccatgccca acttctggct tgggcttctc ctttctctct ttttcgcatt gaaacttggt       480
     tggctgccct cccaggggat gggaacaggc ttttttccgt tattgagaag tctggttctc       540
     ccggcgatca ccctgggaac aggggctgcc gcaaccgttg ttcgaatgac ccgatcttcc       600
     atgcttgagg tgatccgcca ggattatatc tctactgcac gggcaaaggg actctccgaa       660
     aaggccgtca ccagacacca tatgctgaag aatgcaatga ttccgatcgt tacggcggta       720
     ggtttgcaat ttgggcagct actgggaggg gcgatgctta ccgaaacgat tttctcatgg       780
     ccggggcttg ggcgactgat ggtggattcg attaccagta aagacatccc gatggtcctt       840
     ggggcggtga ttttcatggc ggttatgttt tcatttgtaa atcttctcgt cgacattatc       900
     tacgcgttta tcgatccacg catcaaaagt caatacgata aggctggggt aaaacggatt       960
     ggctttcgaa agaggagtat tgcagcatga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page