(data stored in ACNUC7421 zone)

EMBL: CP002116.PE250

CP002116.PE250       Location/Qualifiers
FT   CDS_pept        257236..258060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0254"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="COGs: COG0489 ATPase involved in chromosome
FT                   partitioning; InterPro IPR019591; KEGG: ddf:DEFDS_1268
FT                   ATP-binding protein, CobQ/CobB/MinD/ParA family; PFAM:
FT                   ATPase-like, ParA/MinD; SPTR: Nucleotide-binding protein;
FT                   PFAM: ParA/MinD ATPase like; Anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79410"
FT                   /db_xref="GOA:E1RAB9"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB9"
FT                   /protein_id="ADK79410.1"
FT                   /translation="MAFPPSEEQKAQNERLKKRMSGIKHKVLVMSGKGGVGKSSVSANL
FT                   ALEMASRGVKVGILDTDLHGPNIPKMLGVDDAKLIAYDEGIEPFAVTKNLVAVSLAMAG
FT                   HDVDAPIIWRGPVKIGVIRQFLADVEWGDLDLLVIDTPPGTGDEPLTVAQMIPELDGAI
FT                   VVTTPQEVAILDSRKSVNFAKQLNLPLIGIVENMSGFICPNCGTEHQLFGSGGGERAAK
FT                   EMGVPFLGKIPIDPLLMNAEDSGRSYLSLPDTGPAAAALRSLVDKTAAFIGL"
     atggcattcc ctccgtccga agaacaaaaa gcgcaaaatg agcgcttaaa aaaacgtatg        60
     agcgggatca aacataaggt tctggttatg agcggtaagg gaggtgtcgg caaaagctcg       120
     gtttctgcca accttgccct tgaaatggca tccagaggtg tgaaggtggg aattctcgac       180
     accgatcttc acggtccgaa tataccgaag atgcttggtg ttgatgatgc aaaactgatt       240
     gcctacgatg aaggtatcga gccctttgcg gtgacgaaaa accttgtagc cgtcagtctc       300
     gccatggccg gccatgatgt cgatgctccc atcatctggc gtggtccggt aaagattggt       360
     gttattcggc agttcctggc cgatgtcgaa tggggcgacc tcgatcttct ggtcatcgac       420
     accccgccgg gaaccggaga tgagcctctt acggttgccc agatgattcc tgaacttgac       480
     ggtgcaatcg ttgttacgac gcctcaagag gtggcgattt tagacagccg aaaaagtgtg       540
     aatttcgcca aacagcttaa tcttcctctt atcggtatcg ttgaaaatat gagtggtttt       600
     atctgcccga attgcggtac cgaacatcag cttttcggaa gcgggggagg agagagagca       660
     gccaaagaga tgggggtgcc ttttcttgga aaaattccca ttgatcctct tctgatgaat       720
     gcggaagata gtggtcgttc atacctctct cttcctgata ccggacctgc agcagcagct       780
     ctccgttccc ttgtggacaa gaccgccgct tttatcgggc tttag                       825
//

If you have problems or comments...

PBIL Back to PBIL home page