(data stored in ACNUC7421 zone)

EMBL: CP002116.PE251

CP002116.PE251       Location/Qualifiers
FT   CDS_pept        258190..260424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0255"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR003660:IPR004089; KEGG: dba:Dbac_1917
FT                   methyl-accepting chemotaxis sensory transducer; PFAM:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein; SMART: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SPTR:
FT                   Methyl-accepting chemotaxis sensory transducer; PFAM: HAMP
FT                   domain; Methyl-accepting chemotaxis protein (MCP) signaling
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79411"
FT                   /db_xref="GOA:E1RAC0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC0"
FT                   /protein_id="ADK79411.1"
FT                   /translation="MLKNIRMGVKLVGAFFIVALLVLVVGFVGMIGLRRLNVFISDIGQ
FT                   GRLPAVESLLRMENEVQNIRGSVRTLLSSRLTLDDRQRQYDNIDSARADYGEYRTVYEK
FT                   FPKASEESRKWTEATRLLGELTDLNNSIVDLSKKVEESGIIHPDSFKSTIIELVNDHHV
FT                   LMEQAIAAIGSGTVFTGGDDAESCDLGQFLLTFKTDNPVLLRVLKEVPKYHDAFHEGIS
FT                   EVQDALSRGDRDTAFALYQDKVVRNATRVFELLNQMLGEADRVVQLYDEMNLIAMGDAA
FT                   TVQRSFVDALGWVVSYNSDLAANTVDQAIVNSGQAIRFTIVGMVVASLLALILGLGLTQ
FT                   AITAPMRLGVNFAKAISLGDLGIELSIRQKDEVGQLAEAMREMQIALQDKARVLERIAD
FT                   GDLSVDAKKASEKDGLGESMLRMKKNLNDLLGQVHMAVEQVTAGADQVSQASQSLSQGA
FT                   TEQASSLEEVSSSATEINSQARQNAENATEANALAKKAAADAKNGNSQMMDLKEAMAKI
FT                   NVSSDQIKKVVKVIDDIAFQINLLALNANVEAARAGKYGKGFAVVAEEVRNLAVRSASA
FT                   VQETTSMVEESIRNIELGNAAVGTTAGQLESIVDGAGKVADFLEEIATASREQAQAIDQ
FT                   ISEGLDQIDQVTQSNTASAEESASASEELAGQAQQLQGLIRQFILDERYVSGLRSSGSR
FT                   SLPAPGGRRVPRPSKERTVKEHPREEFETGIAPVSPEDVIKLDDDDFDRF"
     atgctgaaga atatcagaat gggagtgaag ctcgtaggag cctttttcat tgttgcgctc        60
     cttgtgctgg tggtcgggtt cgtcggaatg atcggtctgc gacggctgaa tgtctttata       120
     agtgatatag gccaggggcg gcttcctgca gtggagtcgc ttctcaggat ggagaatgaa       180
     gttcagaaca ttcggggttc cgttcgtacc cttctcagtt ctcggttgac gctcgatgat       240
     cgtcagcgac agtacgataa tatcgattcg gcaagggccg attacgggga gtatcgcacc       300
     gtatacgaaa aatttccaaa agccagtgaa gagagccgta aatggacgga agctacaagg       360
     ctgcttggcg aactgaccga tctcaataat tccatagttg atctttcaaa aaaggtggaa       420
     gaatcaggaa tcatacatcc cgattccttc aaaagtacca ttatagagtt agtgaacgat       480
     catcatgtgc tgatggagca ggcgattgcc gccatcggtt ccggcacggt ttttaccggt       540
     ggagatgatg cggaaagctg tgatttgggt cagttccttt taaccttcaa aaccgataat       600
     cctgttttgc tgcgggttct aaaggaggtc cccaaatacc acgatgcctt tcatgagggg       660
     attagtgagg tccaggacgc tctgagccgg ggggatcggg atacggcttt tgccctctac       720
     caggataaag tggttcgaaa tgcaacaagg gtatttgagt tgcttaatca gatgcttggc       780
     gaggctgatc gagtcgtcca gctttacgat gagatgaatc tcatcgcaat gggggatgct       840
     gcaaccgttc agcgttcttt tgttgatgcc ctcggttggg tcgtttcgta taacagcgac       900
     cttgctgcta atacggtcga tcaagccata gtgaacagcg gtcaggcgat tcgctttacc       960
     atcgtcggca tggtggttgc ctcccttctt gcgctcattc tcggtctcgg ccttactcag      1020
     gcgattaccg cccccatgcg gcttggagta aattttgcca aggccatcag ccttggggac      1080
     ctcggcatcg agctgtcgat acgccaaaaa gatgaggtcg ggcagttggc tgaggccatg      1140
     cgggagatgc aaattgctct tcaggataag gcaagggtgc tcgaacgcat tgcggatggg      1200
     gatctgtcgg tagatgctaa aaaggcttcc gaaaaggatg gcttgggaga atcgatgctc      1260
     cgcatgaaaa agaacctgaa cgatttgctt ggccaggttc atatggccgt tgagcaggta      1320
     actgcgggag cggaccaggt gagtcaggca agtcaaagtc ttagccaggg agcaaccgaa      1380
     caggccagca gccttgaaga ggtctcgtca agtgctaccg agatcaatag ccaggctcgc      1440
     cagaatgcgg agaatgctac cgaagcgaat gctttggcaa agaaagccgc ggccgatgca      1500
     aagaacggta acagccagat gatggacttg aaggaagcga tggccaagat caacgtctcc      1560
     agcgatcaga tcaaaaaggt tgtgaaggta atagacgata ttgcattcca gatcaatttg      1620
     ctcgctctta atgccaatgt cgaggctgct cgtgccggaa agtacggtaa gggatttgcc      1680
     gttgttgcgg aagaggtccg aaatcttgcg gttcgcagtg caagtgcggt tcaggaaact      1740
     acttctatgg ttgaggaatc aatacgaaat atcgaacttg gtaatgcggc agtcgggaca      1800
     acagccggcc agcttgaatc tattgtcgac ggggctggga aggttgctga ttttctcgaa      1860
     gagattgcga ccgcaagccg tgagcaggct caggccattg atcaaatttc agaaggattg      1920
     gatcagatcg atcaggttac ccagagtaat acggctagtg ccgaggagag tgcctcggct      1980
     tccgaggaac ttgccggaca ggctcagcag ctgcagggtc ttattcgtca gtttattctc      2040
     gacgaacggt atgtctcggg tttgcgttct tccggaagcc gttccctccc cgctcccgga      2100
     ggacgtcgtg tccctcgtcc ctcaaaggag cggactgtaa aagagcatcc acgggaagag      2160
     tttgaaacag gtatcgcacc ggtaagtccc gaggatgtca tcaaactgga cgatgatgat      2220
     ttcgatcggt tttga                                                       2235
//

If you have problems or comments...

PBIL Back to PBIL home page