(data stored in ACNUC7421 zone)

EMBL: CP002116.PE252

CP002116.PE252       Location/Qualifiers
FT   CDS_pept        260436..260930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0256"
FT                   /product="CheW protein"
FT                   /note="COGs: COG0835 Chemotaxis signal transduction
FT                   protein; InterPro IPR002545; KEGG: cce:Ccel_2314 CheW
FT                   protein; PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; SPTR: CheW protein; PFAM: CheW-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79412"
FT                   /db_xref="GOA:E1RAC1"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC1"
FT                   /protein_id="ADK79412.1"
FT                   /translation="MSDQVSGSGDVMIDEEDDIVANKYLLSKIGNELYGIDIRFVTDII
FT                   EMQKITEVPDMEEYVRGVINLRGQVIPVIDLRLRFGMAFREYDDRTCIIIVNVGESSIG
FT                   FIVDTVSEVIDIPDGSIDPPPEYKSEGGSSRRFVSGLGKVGDSVKLLLDVEAIVSHTTS
FT                   T"
     atgagcgatc aagtttctgg atccggagat gtcatgattg atgaagaaga tgatattgtt        60
     gcgaataagt atcttctctc caagataggg aacgaactct acggaataga tattcgcttt       120
     gtcaccgaca tcattgagat gcaaaaaatc accgaagtac ctgatatgga agaatatgtc       180
     cggggagtga tcaaccttcg cggccaggtc attcctgtta tcgatcttcg cttgcgtttt       240
     ggtatggctt tccgggaata tgatgatcgt acctgtatta ttattgtcaa cgtcggggag       300
     agttccatcg gttttatcgt cgatacggtt tccgaggtga tcgatatccc cgatggaagc       360
     atcgatcctc cgcctgagta taagagtgag ggtggctctt cccgccgttt tgtctccgga       420
     cttgggaagg tcggagactc ggtaaaactt cttcttgatg tggaggctat tgtttctcat       480
     acgacatcga cataa                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page