(data stored in ACNUC7421 zone)

EMBL: CP002116.PE254

CP002116.PE254       Location/Qualifiers
FT   CDS_pept        complement(261720..262487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tde:TDE1445 hypothetical protein; SPTR:
FT                   Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79414"
FT                   /db_xref="GOA:E1RAC3"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC3"
FT                   /protein_id="ADK79414.1"
FT                   /translation="MISRRNSLQIFGLLISILLTGVGVYGILLQFRTGTTVGDELIRQI
FT                   LLLGEGAFAIIGSLFLMLFFRNTPSPGVLFFILAVQATAFGALRPLSAALFSLNYSYQI
FT                   PAAITRAYYFGRFLSILALFISGLFAAGLALQRRTIMFGSAFFMALTLAAVLPVDISEY
FT                   TPQLLFSIGARSSMFLGYGVIAVLSTANYLIAALHQGNRNYYLVACGVFFMIIGKEFVY
FT                   RSIAPEAAAIGLLCMIVGAYLFGSRTHTIYLWL"
     atgatctcga ggcgaaacag tttacaaatt ttcggtctgc tcatttcgat actgctcaca        60
     ggtgtggggg tatacggaat acttcttcag tttcgcacgg gaacaacagt gggggacgag       120
     ctgatccgac agatccttct gcttggagaa ggagccttcg ccattatcgg ttcgctcttt       180
     ttgatgcttt tttttaggaa tacaccaagt ccaggcgtcc ttttttttat tcttgccgta       240
     caagcgaccg ccttcggcgc gctcagaccc ctatctgccg cacttttctc actcaattat       300
     tcatatcaga tacctgccgc aataacacgt gcctactact tcggacggtt tctttcgatt       360
     cttgccctct tcatctccgg ccttttcgcg gcaggtctcg cactccagcg acggaccatc       420
     atgttcggat cggctttctt catggccctt acgcttgcgg cggttctgcc cgttgatata       480
     tcggaataca ccccgcaact gcttttttcc atcggagcac gcagtagcat gtttcttggc       540
     tacggggtca tcgccgtgct ctcgacggca aactatctca tagcagcctt gcatcagggg       600
     aatcgaaact attacctggt tgcctgcggg gttttcttca tgatcatagg gaaggaattt       660
     gtctatcgat ccatcgctcc ggaggcagcg gcgataggcc ttctttgcat gatcgtgggt       720
     gcttatctat tcggcagcag aacgcatacc atatatctct ggctttga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page