(data stored in ACNUC7421 zone)

EMBL: CP002116.PE255

CP002116.PE255       Location/Qualifiers
FT   CDS_pept        complement(262520..264109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0259"
FT                   /product="Glycoside hydrolase family 79"
FT                   /note="InterPro IPR005199; KEGG: mmw:Mmwyl1_1639
FT                   hypothetical protein; PFAM: Glycoside hydrolase family 79;
FT                   SPTR: Putative uncharacterized protein; PFAM: Glycosyl
FT                   hydrolase family 79, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79415"
FT                   /db_xref="GOA:E1RAC4"
FT                   /db_xref="InterPro:IPR005199"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC4"
FT                   /protein_id="ADK79415.1"
FT                   /translation="MNGNYYPVSMSSPRHYTICIGSRKPIRSLPADFLSLTIDSSLLLG
FT                   GHWWGKSRSFAKGVSGEQVAPLDLEHSQLVAYAAQLAPAMLRIGGTEADWVRYKMGKKA
FT                   LRKLRGAKPASHRIGNSNDRPAYELVLKKGVWKRLNRFIKESGFDLLFTLSAGPADRDS
FT                   NGAWRSDNAMRLVAYSVQKGFRVAAWEFGNEVNGFPFLYGPKKRVSASQYSRDFEYFSE
FT                   SVKHIDPQAKIIGPASAIWPIIGEPNPIIKKLCVSPAARHLDAVSWHYYPQQSHHGPIA
FT                   VRRAGTYRMLSPGNLNDIVRWNRNIQRYLKKSREHPTSTENWLTETAHALYGGEPGLSD
FT                   SFVSTLWWLDELGVLARNGVDKVFRQSLIGARYGLLDQESMKPKPDYYASFLWKKLMGN
FT                   LVLETGTTIGTNKKLRYYRHTTGAYFAGSAAEALLLINLNRKTSAHVEITTPDAPFSIG
FT                   HTILLQADGGFTSKSMLVNGVPAEDDLVFSWGTKKVMKKYKISGKKNERITKELSLPPL
FT                   SALFYLFARPEN"
     atgaatggga attattatcc tgtatctatg agctcacctc gccattatac aatatgtatc        60
     ggcagcagaa agccgatacg aagtttacct gcagattttc tttcccttac catcgacagc       120
     tccctcctgc tgggcggtca ttggtgggga aaaagccgat cattcgcaaa aggagtctcc       180
     ggtgagcagg ttgcgcccct tgaccttgaa cactcacaac ttgttgccta cgcagcacag       240
     ctcgctcctg ccatgttacg gatcggagga accgaagcgg attgggtcag atataagatg       300
     ggaaaaaagg cacttcgaaa gctaagggga gccaagccgg ccagccaccg gataggaaat       360
     agcaacgatc gccccgctta tgaattggta ctcaaaaagg gagtatggaa gcgattaaac       420
     cgttttatca aggaatcggg ttttgatctc cttttcacgt taagtgccgg gcccgccgat       480
     agggattcaa atggagcctg gaggtcagat aacgccatga gactggtggc ctattcggtg       540
     caaaaaggat tccgcgttgc ggcatgggaa ttcggcaatg aggtaaacgg ctttccgttt       600
     ctttacgggc cgaaaaagcg ggtttcggca tcccagtatt ctcgtgactt cgaatacttt       660
     tcggaaagtg tgaagcatat tgatccgcag gccaagatta tcggtcccgc ttcggcaata       720
     tggccgatca tcggggaacc caaccccatc ataaaaaagc tctgtgtctc tcccgcagcg       780
     cgacacctgg atgcggtttc ctggcactat tatccccaac agtctcacca cggaccgata       840
     gccgtcagaa gagccggaac ctaccggatg ctgtcgcccg gaaaccttaa cgacatagta       900
     cgctggaacc gaaatataca aagataccta aaaaaaagca gagagcaccc tacaagcacg       960
     gagaactggt tgacagagac cgctcatgct ctctacggag gggagcctgg cctttcagac      1020
     agctttgttt ccaccctttg gtggcttgat gagctgggag ttttagcgcg gaacggagtc      1080
     gacaaggtgt ttcgacaatc gctcatcgga gcacgatacg ggctcctgga ccaggagagt      1140
     atgaaaccaa agcccgacta ttacgcctcc tttctctgga aaaagctcat gggaaacctg      1200
     gttctcgaaa cgggcacgac catcggcacc aataagaaat tacgttatta ccgtcacacc      1260
     acgggggcct atttcgcagg aagcgctgcc gaggctctac tccttatcaa ccttaacagg      1320
     aagacatcgg cacatgtcga aataaccaca cccgatgcac ccttttccat aggccacaca      1380
     attcttttac aggcagatgg aggcttcact tccaaaagca tgcttgtaaa cggagttcct      1440
     gcggaagatg atttggtctt ttcctgggga accaagaagg tcatgaaaaa atacaagatc      1500
     agcggaaaga agaatgaacg aataacaaaa gagctctcgc tgcctcctct ttctgctctt      1560
     ttctacctct ttgcacggcc tgaaaattga                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page