(data stored in ACNUC7421 zone)

EMBL: CP002116.PE256

CP002116.PE256       Location/Qualifiers
FT   CDS_pept        264202..264897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0260"
FT                   /product="Protein of unknown function DUF2259, secreted"
FT                   /note="COGs: COG5497 secreted protein; InterPro IPR018725;
FT                   KEGG: tde:TDE1519 hypothetical protein; PFAM: Protein of
FT                   unknown function DUF2259, secreted; SPTR: Putative
FT                   uncharacterized protein; PFAM: Predicted secreted protein
FT                   (DUF2259)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79416"
FT                   /db_xref="InterPro:IPR018725"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC5"
FT                   /protein_id="ADK79416.1"
FT                   /translation="MHKRALLAAFLLTLACSGAFAGDVAVFENLGFSDDSRYLLFGQYG
FT                   ILSDETRAYAELYAVDVAKNSYLSGGVLKKVYSDEIFPGQDGSGALYMALREFSPIVSK
FT                   YKFNHLATGRMVYLLLNGAEPQDRLEFRDFQRGDSFSVDLIQHRYGEGEGTNLSSSFHI
FT                   SVMITDAAGKSRTYQVGHPDFKRKGVLEYRIKEVFFSPDEKGLVFVVERDEVDGNGNNI
FT                   RYMVETLRW"
     atgcataaac gagcactgtt ggcagcgttc ctgcttaccc ttgcctgtag cggggctttc        60
     gccggagatg ttgcggtctt tgaaaaccta ggcttttctg atgactcccg atatcttctt       120
     ttcgggcagt acggtattct ttctgatgaa accagggcct atgcggagct ctatgccgtc       180
     gatgtggcaa aaaatagtta tctttctggt ggtgttctca aaaaggtcta ttctgacgaa       240
     atttttccgg gccaagatgg ttccggagcc ctttatatgg cacttcggga gttttctccc       300
     attgtttcca aatacaaatt caatcatctg gccaccggac ggatggtcta tcttttgctc       360
     aatggagcag agccgcagga tcggcttgag tttcgtgact ttcagcgagg cgacagcttt       420
     tctgtcgatc ttatccagca tcgctatggt gaaggggaag ggacgaatct atcctcatct       480
     ttccacatct cggtaatgat taccgatgcc gcggggaaaa gcaggaccta tcaggtcggt       540
     catcccgatt tcaaacggaa gggcgtgttg gaatatcgca tcaaagaggt ctttttctct       600
     cccgacgaga agggactcgt tttcgtcgtg gaacgggacg aggtcgacgg taatggaaac       660
     aatattcgct atatggtgga gactctgcgc tggtag                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page