(data stored in ACNUC7421 zone)

EMBL: CP002116.PE257

CP002116.PE257       Location/Qualifiers
FT   CDS_pept        265017..266447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0261"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="COGs: COG0442 Prolyl-tRNA synthetase;
FT                   InterProIPR002316:IPR004499:IPR002314:IPR004154:IPR
FT                   016061:IPR006195; KEGG: paa:Paes_1587 prolyl-tRNA
FT                   synthetase; PFAM: Anticodon-binding domain protein; tRNA
FT                   synthetase class II (G H P and S); Prolyl-tRNA synthetase,
FT                   class II-like; PRIAM: Proline--tRNA ligase; SPTR:
FT                   Prolyl-tRNA synthetase; TIGRFAM: prolyl-tRNA synthetase;
FT                   PFAM: Anticodon binding domain; Prolyl-tRNA synthetase,
FT                   C-terminal; tRNA synthetase class II core domain (G, H, P,
FT                   S and T); TIGRFAM: prolyl-tRNA synthetase, family I"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79417"
FT                   /db_xref="GOA:E1RAC6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC6"
FT                   /protein_id="ADK79417.1"
FT                   /translation="MAEKITPRSENYSQWYVDIILNAKLADYSPVKGSMVIRPHGYALW
FT                   EAIQRNLDDMFKATGHTNAYFPLLIPESFIKKEAEHVEGFSPELAVVTHAGGEELEEPL
FT                   VIRPTSETIIWSMYKKWIQSYRDLPLLINQWANVLRWEKRTRLFLRTSEFLWQEGHTAH
FT                   ATEKEAREETLRMLNVYKEFAEKWMAIPVLTGVKSPSEKFAGAIDTYAIEAMMQDHKAL
FT                   QAGTSHFLGQNFAKAFDVTFQNDTGSLEYVWATSWGVSTRLVGALIMTHSDDKGLVVPP
FT                   KLSPVEAVIIPIFRNKNKEEVVGYARKLYDRMKDEFRVKLDADDSNSPGWKFAEWEMLG
FT                   CPVRIELGPRDMENGKAVLVRRDNGEKEIVDIEAVPARVGELLESIQTTLFQRALENRE
FT                   THTYDVDSYDRFKAIFDGEGGFIRMPWCGDAECEAAIKEETKATIRLIPFEQPELKGAV
FT                   CPRCGKPADKIAVYARSY"
     atggccgaga aaatcacccc aagaagcgaa aactattcac agtggtatgt ggatatcatt        60
     ctcaatgcaa aacttgccga ctactccccg gtaaagggtt ccatggttat ccggccgcat       120
     ggctatgcct tatgggaagc tatccagcga aaccttgatg atatgtttaa ggcaaccggg       180
     catacgaatg cctatttccc gttgctcatt cccgaaagct tcattaagaa ggaagcagaa       240
     catgtcgagg gctttagccc ggaactggcg gtagtgaccc atgccggggg agaggagctt       300
     gaagagccgc tggtcattcg tcctacttcc gagacgatta tctggagcat gtataaaaag       360
     tggatccagt cctacaggga tcttccgctt ttgattaatc aatgggctaa tgtcctgcga       420
     tgggaaaagc gaacacggct ttttctcagg acctccgaat tcctctggca ggaggggcat       480
     accgctcatg ctaccgaaaa ggaagcacgg gaagagacgc tcaggatgtt gaacgtctac       540
     aaggagtttg ccgaaaagtg gatggccatc ccggttctga ccggtgtgaa aagccccagc       600
     gagaagtttg ccggagccat cgacacctat gccatcgaag cgatgatgca ggaccacaag       660
     gccttacagg caggaaccag tcacttcctc gggcaaaatt ttgcaaaggc ctttgacgtt       720
     acctttcaga acgatacggg tagtcttgag tatgtgtggg caaccagttg gggagtttcc       780
     acacgcttgg tcggtgcctt gatcatgacc cattccgatg acaaggggct tgtcgttcct       840
     cctaaactgt cccctgtcga agcggttatt attccgattt tccgtaacaa aaataaagaa       900
     gaggttgtgg ggtatgctcg caaactctac gatcgcatga aggatgagtt ccgggttaag       960
     cttgatgccg atgattccaa cagccccgga tggaaattcg ccgaatggga gatgttgggt      1020
     tgtcccgtcc ggatagagct tggtccgaga gatatggaaa acggcaaggc cgtacttgtt      1080
     cgccgtgata acggtgagaa ggagattgtc gatatcgagg ctgtacccgc gagagtaggg      1140
     gaattgttag aatcgataca gacaactctt ttccagaggg cccttgaaaa tagagagact      1200
     catacctacg atgtcgatag ctacgatcgc tttaaggcga tcttcgacgg tgagggcggc      1260
     tttattcgaa tgccctggtg tggagatgcc gagtgcgaag ctgcgatcaa agaggagaca      1320
     aaggctacca ttaggcttat cccctttgaa cagccggagc tgaaaggggc tgtctgtccc      1380
     cgttgtggaa agcctgccga taaaattgca gtctatgccc gctcttattg a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page