(data stored in ACNUC7421 zone)

EMBL: CP002116.PE258

CP002116.PE258       Location/Qualifiers
FT   CDS_pept        266484..267131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saz:Sama_1067 putative sulfate transporter
FT                   YchM; SPTR: Sulfate permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79418"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC7"
FT                   /protein_id="ADK79418.1"
FT                   /translation="MRSTFHFLALFSILCTVAVSSISASPHMEGVELFGGGIWTGNSRS
FT                   DAGAPSPIYPSLTIGLPLRLGNGPFSFVPALTLYKAWYLYDESEEAAIPAELEQRDITA
FT                   VEIIIDSSFRFDMIKRKSFVTGPELSLSFDLPVPIVVWENEDESSSLVSDLYDSGKFFL
FT                   PGVGWHWTVILHDTHPLLFNLKSYLPLHRFWDGEDLPFYDRLKIALRVGYRF"
     atgaggtcca cgtttcattt tcttgcgctt ttttctattc tttgcacagt tgccgtgtcg        60
     tcgatttcgg cttctcccca tatggaaggg gtcgaacttt tcggcggggg tatttggacc       120
     ggaaatagtc gaagcgatgc gggagctccc tctcctatct atccaagcct gacgatcgga       180
     ctgcccctgc gactggggaa tggccctttt tcatttgtcc ctgctctgac cctttacaag       240
     gcgtggtatc tttacgatga atccgaggaa gcggcgattc ccgcagagct cgaacagcgt       300
     gatattaccg ctgtcgagat cattatcgat tcatcgtttc gattcgatat gataaagcgt       360
     aagagctttg tgaccggacc tgagctttct ctctcttttg atcttcccgt ccctattgtg       420
     gtctgggaga atgaggacga gagctcttct ctcgtttccg acttgtacga cagcggaaaa       480
     ttctttctac ccggagttgg ctggcactgg actgtcatac tccacgatac gcatcccctg       540
     cttttcaatc tgaaaagtta cctccccctt caccgtttct gggatggtga ggacctcccc       600
     ttttacgatc gcctgaaaat tgctcttcgg gtcggttatc gtttctga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page