(data stored in ACNUC7421 zone)

EMBL: CP002116.PE26

CP002116.PE26        Location/Qualifiers
FT   CDS_pept        22389..23273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0026"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: fnu:FN0398 peptide ABC transporter permease; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Putative uncharacterized protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79186"
FT                   /db_xref="GOA:E1R6Q4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q4"
FT                   /protein_id="ADK79186.1"
FT                   /translation="MSSGPKARSLWKETWRRLKKNRLAVAGMLFLITLVLIAIATIVID
FT                   LVMHNAIYNDYVIKQNLRLRLKGPSPEHIFGLDEFGRDIFLRMIWGIRYSLFMGTIAIA
FT                   LSTIAGGILGAIAGYYGKATDNIIMRFMDVLLAIPSMLLATAIVAALGTSLTNLLLAIA
FT                   ISYVPTFARTVRASVLTIKDQEFIEAARALGAGDGRIIFKYIIPNSLAPLIVQATLGVA
FT                   GAILSIAGLSFLGLGIQPPTPEWGSMLSSARSYIREGWHITVIPGLGIMLTILALNVMG
FT                   DGLRDALDPHLKN"
     atgagtagcg gacccaaggc tcgttccctc tggaaagaaa cctggagaag gctgaaaaag        60
     aacaggctcg ccgttgccgg tatgcttttt ttaattaccc tggtgctgat cgccattgca       120
     acgatcgtca tagatttggt gatgcacaac gcgatctata atgactatgt cattaaacag       180
     aacctgcgac ttcgtctaaa agggcccagc cccgagcaca tttttggcct tgatgagttc       240
     ggccgggata ttttccttcg tatgatttgg ggaattcgct attcgctctt tatggggacg       300
     attgcgattg ccctatccac cattgccggt ggcatacttg gggcgatcgc cggctattat       360
     ggcaaggcga ccgacaatat catcatgcgc ttcatggatg tccttcttgc cattccatcc       420
     atgcttttgg caaccgctat tgttgccgcc ttaggaacga gtcttaccaa cctgcttttg       480
     gcgattgcca tcagctatgt acccaccttt gcccgtaccg tcagggcttc ggtgctgacg       540
     atcaaggacc aggagttcat tgaggcggca agggcgctag gggcgggaga cggaaggatc       600
     atcttcaagt acatcattcc gaattcactt gcacccttga tcgtccaggc cacattgggc       660
     gtggctggtg caattctgtc catagccgga ctctcgtttt tggggctcgg tattcagcct       720
     cccactcctg agtggggatc gatgctctcg agtgcccgtt cctacattcg tgaggggtgg       780
     cacatcaccg ttatcccggg gctcggcatc atgctaacca ttttggcact gaatgtcatg       840
     ggtgacgggc tacgcgatgc acttgacccg catctgaaga actga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page