(data stored in ACNUC7421 zone)

EMBL: CP002116.PE260

CP002116.PE260       Location/Qualifiers
FT   CDS_pept        complement(268436..269101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpi:Cpin_6701 short-chain
FT                   dehydrogenase/reductase SDR; SPTR: Short-chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79420"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC9"
FT                   /protein_id="ADK79420.1"
FT                   /translation="MGKRVLITGKTTKLGNLLVEHYLSQGWQVVATVKQDEEKRNDTEI
FT                   DSNLLIRTWNRRSPLAAKNVLLGGINHFGGIDEAIIIFPVDGENRPLHELPSAAIEAAI
FT                   DGQIKSQLFMVKEVLAYFQKEKRGQLSLIRNNEGADVLPPLEAICSGSFQALSRSLFTF
FT                   YQNEKVYINSFESSTGDAKGFVDFIMKTLDEKARDQHGKMYRFHDKGVLGALGRNLRK"
     atgggtaagc gggtgctcat caccgggaaa acaacaaagc tgggaaatct tctcgtcgaa        60
     cactatcttt cacaaggatg gcaggtcgtt gcgacggtca agcaggatga agaaaagcgg       120
     aatgatacgg agatcgattc gaacctcctc atcaggacct ggaaccgcag aagtcctctg       180
     gccgcaaaaa atgttttact tggcggcatc aatcactttg gaggcataga tgaggcaatc       240
     atcatcttcc ctgtggacgg agaaaacagg ccgcttcatg aacttccatc ggccgcaata       300
     gaagccgcca tcgacgggca aattaaaagc cagcttttta tggtaaagga ggtgctcgcc       360
     tattttcaaa aagaaaaaag agggcagctc tcacttatca ggaataacga aggcgcagat       420
     gttttaccac ccctggaagc tatctgttca ggcagttttc aggccctttc aagaagcctt       480
     tttacctttt accaaaatga aaaggtatac ataaatagct ttgaatcatc aacaggagat       540
     gcaaagggat ttgtcgattt catcatgaag accctggacg agaaggcaag agatcagcat       600
     gggaaaatgt atagattcca tgacaagggt gtcttgggag ctctcggcag gaatttgcgg       660
     aaatag                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page