(data stored in ACNUC7421 zone)

EMBL: CP002116.PE262

CP002116.PE262       Location/Qualifiers
FT   CDS_pept        complement(270879..274286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0266"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase; InterPro
FT                   IPR006589:IPR006047; KEGG: aba:Acid345_1492 alpha amylase;
FT                   PFAM: alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain; SPTR: Alpha amylase; PFAM: Alpha
FT                   amylase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79422"
FT                   /db_xref="GOA:E1RAD1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAD1"
FT                   /protein_id="ADK79422.1"
FT                   /translation="MSVEKYRKGMPISVKAREQFRIADLFPEQKEGRREKEPGTTYAEA
FT                   QEIAQLLNRKNKADRYPEHRVSTASVFALGLIRTFQYIIIKLYSEKNGGEVSLQLLKHL
FT                   AQSPGRKETESTLSSFETEFFKPSHSARTEEEQIEELLLLWLTNQNRAARFMRGLFSDR
FT                   DLERHTSYQEVIASCYLFFSKLQGFGPGNLHLMDMLRSPAINYPDNLLAQLEYIRDHWG
FT                   PLLGSFLELLLRGIDYLKEEQRPFFPPGPGPSRIPIFRKGSEEYERFSSDSHWMPEVVL
FT                   IAKSTLVWLNQLSRFYHREIHRLDQIPDQELDVLAERGFTALWLIGLWERSDASRKIKQ
FT                   WSGNQEAAASAYSLKRYEIAEELGGWEALDNLRERCRQRGIRLASDMVPNHTGLDSDWL
FT                   FEHPEWFIQCSAPPFPGYTYSGESVVDHPDIEVHLEDHYWDRSDAAVTFQYVDRRSGSC
FT                   RYIYHGNDGTSMPWNDTAQLDYLNPHVREVVIQTILHVARNFPIIRFDAAMTLAKKHIQ
FT                   RLWYPQPGHGGDIPSRSRFGIDETEFHERIPEEFWREVVDRVAAEVPDTLLLAEAFWMM
FT                   EGYFVRTLGMHRVYNSAFMNMLKNEENAKYRQTIKNTLEYDPEILKRFVNFMNNPDEDT
FT                   AYAQFGDGDKYFGVCTMMTAMPGLPMFGHGQIEGFREKYGMEFRKAYLSEEPDRMLIER
FT                   HEREIFPLTRIRSLFAEVEHFNFYDFHETEGRVNENVFVWSNKKGEERAIVAYNNCYQS
FT                   STGSFSESVPVNRRRENGRRELVTGFLAANLDFTSDDNWFLIFQEQRSGLWFIRENKNL
FT                   FGEGFGLILAGYQSQLFLNFREVYDSLGIYRYLCEKLGGSGTKDIERMEKELRAAPVRE
FT                   PFRRLLSKERIAQVEDSFRSGDSSLLTLLDDTIEDYRAFLAGCRQVGYGDAITAAEEEY
FT                   RDQMIRLDLLLACKTEEEPSLPSGAEGYLLRGLSIAPEAAVVLYAKALLTPLWRLLDSK
FT                   AEKAGTFALCDAAEAIEELLLPELFDEALLAVGVAEPFLPELRLLISLLPRLENWTRLT
FT                   LQGSPAERLKQILSIPEVARYCGINEYEGIRWYGGESLQQLFWYLAVLAMPDDRALGYE
FT                   IVRRWHVAEEEADYRLDQLFELLENQAS"
     atgagtgtag aaaagtacag gaaaggtatg cccatctcgg taaaggcccg tgagcaattt        60
     cgaatcgcgg accttttccc ggaacaaaag gaaggaagaa gggaaaaaga gcctggaacc       120
     acctatgcag aagcccagga gatagctcag ctactcaacc ggaagaataa ggccgatcga       180
     tatcccgagc atcgagtctc cactgcttcc gtcttcgcct tgggactcat caggaccttc       240
     cagtacatta tcataaagct ttactcggaa aaaaacggag gagaggtttc tctccagctg       300
     ctgaaacatc ttgcacaaag ccccgggaga aaggaaaccg aatcgaccct ttcttctttc       360
     gaaacggaat tcttcaaacc ctcgcactcg gcaaggaccg aagaagaaca gattgaagag       420
     ttactactcc tctggctgac aaatcaaaac agagccgccc gttttatgcg cggccttttc       480
     agcgacaggg atctcgaacg ccacacctcc tatcaagagg tcattgccag ttgttacctc       540
     ttttttagta aactacaggg cttcggtccc ggaaatcttc atctcatgga catgctcaga       600
     agcccagcca taaactatcc ggataatctg cttgcccagc tggaatacat ccgagatcat       660
     tggggtcctc ttctcggctc ctttctcgag cttctcctcc gaggaatcga ctacctaaaa       720
     gaagaacaac gacctttttt cccgccggga ccagggccaa gccgtatccc catcttcaga       780
     aagggaagcg aagaatatga gcgcttttca agtgatagtc actggatgcc ggaagtggtt       840
     ctgatcgcaa aaagtacgct tgtgtggctt aaccagctct ctcggttcta ccaccgtgaa       900
     attcacaggc tggaccagat tcccgatcag gagctcgatg ttctggcaga gcgaggattc       960
     accgctcttt ggctcattgg gctatgggaa cgaagcgatg caagtcggaa aataaaacag      1020
     tggagcggga accaggaagc ggccgcatcg gcctacagtc tgaaacgata cgaaattgcc      1080
     gaggagctgg gaggatggga agccctggat aatctgcggg agcgatgcag acaaagaggg      1140
     attcgcttgg ccagcgacat ggttccgaac catacggggc tcgattccga ctggctcttc      1200
     gaacatcccg agtggttcat ccaatgcagt gcccctcctt ttccgggcta tacctacagc      1260
     ggagaaagcg tcgtggacca ccccgatatc gaggtgcacc tcgaggacca ttactgggat      1320
     agaagcgatg ccgctgtaac cttccagtat gttgatcgac gctctggaag ctgtcgctat      1380
     atctatcatg gtaacgacgg aacaagcatg ccgtggaacg ataccgcaca gctcgattat      1440
     ctcaatcccc atgtcaggga ggtggtgatt cagaccatcc tgcatgtggc tcgcaacttt      1500
     cccatcatca ggtttgacgc cgctatgacc cttgcaaaga agcacattca acggctctgg      1560
     taccctcaac cggggcacgg cggcgatatt ccaagccgca gccggttcgg aatcgatgag      1620
     acggaatttc acgaacggat tcccgaggaa ttttggagag aggtagtgga cagggttgcg      1680
     gccgaggtgc cggatactct tctccttgcc gaggcctttt ggatgatgga gggctacttc      1740
     gttcgaaccc tcggtatgca tagagtctat aacagcgcat tcatgaacat gctcaaaaat      1800
     gaagaaaacg caaagtatcg acaaaccata aaaaacaccc ttgagtacga tccggaaatt      1860
     ctcaagcgtt ttgtcaattt catgaataat ccggacgaag ataccgccta cgctcagttc      1920
     ggcgacggcg acaagtattt cggcgtctgt accatgatga ccgctatgcc gggcctgccc      1980
     atgttcgggc acggacagat cgaagggttt cgtgaaaaat acggcatgga atttcggaaa      2040
     gcatatctca gcgaagaacc ggacagaatg cttatcgaac gccacgagcg ggagattttt      2100
     cccctcacca gaattcgcag cctctttgcc gaagtagagc acttcaattt ttacgatttc      2160
     cacgaaacag aggggcgggt caatgaaaat gtttttgtct ggtcgaataa aaagggagaa      2220
     gaacgcgcaa ttgtcgcata caacaactgt tatcaatcaa gcactgggag cttttcggaa      2280
     tcggtcccgg ttaaccgtcg tcgagaaaac ggaaggagag agctggtaac aggctttctt      2340
     gccgcaaatc tcgactttac aagcgatgac aactggtttc tcatctttca ggagcagcga      2400
     tcgggactct ggttcatcag agaaaataaa aatctcttcg gtgagggatt cggcctgatt      2460
     ctcgcaggat atcagagcca gctcttctta aactttcggg aagtgtacga tagcttaggt      2520
     atataccgtt atctttgcga aaagctgggt ggaagcggaa caaaggatat agaacgaatg      2580
     gagaaagagc tacgcgcggc accggtaaga gagcctttcc gacgccttct ttcaaaagag      2640
     cgcattgcac aggttgaaga ctcctttcga agcggagact ccagcctgct tacgcttctt      2700
     gacgatacga tcgaagacta ccgcgctttc ctggcaggat gcagacaggt cgggtatgga      2760
     gacgctatca ctgcggcaga ggaagaatat agggatcaga tgatcaggct tgatcttctg      2820
     cttgcctgta agaccgaaga ggagccgtcc ctgccatcag gggctgaggg atacctactg      2880
     cgggggcttt ccattgcacc ggaagcagcc gttgtactct atgcaaaggc gcttttaacc      2940
     cctctttggc gccttttaga cagcaaggcg gaaaaggccg gaacctttgc actctgcgat      3000
     gcggccgagg caattgagga gctacttctt cccgagctct tcgatgaagc actgctggcg      3060
     gtaggagttg ccgagccgtt cctgccagag ctcaggctcc ttatttccct gttgccgcga      3120
     ttggaaaact ggacaaggct cacgctgcaa ggttcccctg cggagcgact caaacagata      3180
     ctatcgatac cggaagtggc ccggtactgc ggcattaacg aatacgaagg aatccgctgg      3240
     tacggggggg agagcctcca acagcttttc tggtatcttg ccgttctggc aatgcccgac      3300
     gacagagcct tgggatatga gatagtacgc cgctggcatg tggcggaaga agaagccgac      3360
     taccgccttg atcagctttt tgagctgctg gaaaatcagg cctcgtag                   3408
//

If you have problems or comments...

PBIL Back to PBIL home page