(data stored in ACNUC7421 zone)

EMBL: CP002116.PE27

CP002116.PE27        Location/Qualifiers
FT   CDS_pept        23285..24262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0027"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component;
FT                   InterProIPR010066:IPR003593:IPR003439:IPR013563:IPR 017871;
FT                   KEGG: fnu:FN0399 peptide ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Putative uncharacterized protein;
FT                   TIGRFAM: oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter; Oligopeptide/dipeptide
FT                   transporter, C-terminal region; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATP-binding
FT                   protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79187"
FT                   /db_xref="GOA:E1R6Q5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q5"
FT                   /protein_id="ADK79187.1"
FT                   /translation="MDEPLLTVDNLTVNYETDDGIVQALNGVSISVGQGETLGLVGETG
FT                   AGKTTLARGIMRLVPSPPGKIKSGSIMFEGRDLLKLSEAEMRTVRGKSVSMIFQDPMTS
FT                   LNPILSIGEQIQEVIATHNRELSKEKLRKQANDMLELVGISADRAHEFPHQFSGGMKQR
FT                   VIIAIALACNPKLLIADEPTTALDVTIQAQVLDMIRTLKEKMNTAMLLITHDLGVVAQN
FT                   CNRVAVIYAGEIVEMGTIRQIFKNPTHPYTIGLLESIPSLAKKEVHRLNPVKGMMPDPT
FT                   NLPVGCKFNPRCKHAFEPCYGKVPPLTDIGAGQLVRCYLAKERG"
     atggacgagc ctttactcac ggtagataac ctgaccgtta attatgaaac agacgatggt        60
     attgtgcagg cgctgaacgg agtctccatt tctgtggggc agggagagac acttggtttg       120
     gtcggggaga ctggggcggg aaagacaacc cttgcaaggg gaatcatgcg cctggttcct       180
     tctcctccgg gaaagatcaa atccggatca atcatgttcg agggtaggga cttgctgaag       240
     ctgagcgaag ccgagatgcg aactgttcgc ggtaagtccg tttccatgat ttttcaggat       300
     ccgatgacca gcctgaaccc gatcttgagc atcggcgaac agatacagga ggtgattgcc       360
     acccacaatc gggaactctc gaaggaaaag ctgcggaagc aggcaaacga tatgctggaa       420
     ttggttggaa tctccgcaga tcgggcacat gaattccctc atcagttttc cggtgggatg       480
     aagcagcgcg tcattattgc catcgccctt gcctgcaatc cgaagctgtt aattgccgat       540
     gagccgacca cggctctgga tgtgaccatc caggcgcagg ttttggacat gatcaggacc       600
     ctgaaggaaa agatgaacac ggccatgctc cttattaccc atgatcttgg ggttgtagcc       660
     cagaactgca acagggtggc ggttatctat gcgggagaga ttgtcgaaat ggggaccatt       720
     cgccagatct tcaagaatcc gacccaccca tacaccattg ggctgctcga atcgatccct       780
     tctcttgcaa aaaaagaggt tcatcgcctc aatccggtta agggaatgat gcccgatccc       840
     accaatctgc cggtggggtg caaattcaac ccccgatgta agcatgcctt cgaaccatgc       900
     tatggcaagg taccacctct taccgatatt ggcgctggtc agctggtcag atgctatctc       960
     gcaaaggaga ggggttga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page