(data stored in ACNUC7421 zone)

EMBL: CP002116.PE276

CP002116.PE276       Location/Qualifiers
FT   CDS_pept        287552..288463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0280"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847:IPR005119:IPR003006; KEGG: dhd:Dhaf_1104
FT                   transcriptional regulator, LysR family; PFAM: LysR
FT                   substrate-binding; regulatory protein LysR; SPTR:
FT                   Transcriptional regulator, LysR family; PFAM: LysR
FT                   substrate binding domain; Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79436"
FT                   /db_xref="GOA:E1RAE5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAE5"
FT                   /protein_id="ADK79436.1"
FT                   /translation="MDIHRIRCFLSLAELMNFTRAAEKQCITQSSMSQQIQGLENEIGV
FT                   QLFVRNKRNVMLTPAGEFLKQEFLELIEKYEAVLAQTRRIANRENNHLSICYHGPPNWA
FT                   FLLPIIQKFQKENEDFQLELSVENWGEMPNGLITRQFDVAFVEGAEIVHNNQIESFYLY
FT                   RDYTCFAMHTSHPLARKTKLTEEDIKGEQIVMVDQHVGAKSMHGVHERLFRSGVDMSKV
FT                   TLVKKFENCMAMVSSGMAIVPMPRSFREPDQSKIVYIDYDRKETYTDIYIAWLKCNTTP
FT                   SLFAFIEFIKDSIRGLLPSLSF"
     atggatatac accgtatacg ctgtttttta agtctggcgg aacttatgaa ttttacccgt        60
     gcagcggaaa aacagtgtat tacccagtct tccatgagcc agcagattca gggacttgaa       120
     aatgaaatcg gcgtccagtt gtttgtaagg aacaaacgga atgttatgct gactcctgcc       180
     ggagaatttc tgaagcagga atttcttgag ttaattgaga aatacgaagc ggtgttggcc       240
     caaaccaggc gaattgcaaa tagagaaaat aatcaccttt ctatttgcta tcatggtccc       300
     ccaaactggg cctttctcct gccgataatt cagaaatttc agaaagaaaa tgaggatttc       360
     caactggagc tatccgttga aaactgggga gagatgccca acggcttgat cacaaggcag       420
     tttgatgtgg cctttgtcga aggagccgag atcgtgcata ataaccaaat cgaaagtttt       480
     tatttatacc gggattatac ctgttttgcc atgcatacat cccaccctct agcaagaaag       540
     acaaaattga cggaagagga tatcaaaggg gagcagatcg ttatggttga ccagcatgtg       600
     ggtgccaaaa gtatgcacgg ggtccatgaa cggttgttcc ggagcggcgt tgatatgagc       660
     aaagttacat tagtaaaaaa atttgaaaac tgtatggcca tggtttcgtc gggcatggcc       720
     atagttccta tgccgaggtc gttcagagaa cctgatcagt cgaaaatcgt ctatatcgac       780
     tatgacagaa aagaaaccta tacggatatc tatattgctt ggttgaaatg taataccact       840
     ccttccttgt ttgcgttcat tgagttcatc aaagacagta ttcgaggctt gctcccgagt       900
     ctttcgtttt ag                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page