(data stored in ACNUC7421 zone)

EMBL: CP002116.PE28

CP002116.PE28        Location/Qualifiers
FT   CDS_pept        24264..25232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0028"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component; InterPro
FT                   IPR010066:IPR003593:IPR003439:IPR013563; KEGG:
FT                   aco:Amico_0787 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Oligopeptide transport ATP-binding
FT                   protein AppF; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter;
FT                   Oligopeptide/dipeptide transporter, C-terminal region;
FT                   TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79188"
FT                   /db_xref="GOA:E1R6Q6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q6"
FT                   /protein_id="ADK79188.1"
FT                   /translation="MAEKQEILRVEHLKKYFDTPSGSLHAVDDLSFSINKGETLGVVGE
FT                   SGCGKSTLGRTILRLHEPTSGNIWFEGREINSCNKREMKNLRKHMQIIFQDPFASLNPR
FT                   MTVGETISESLLIQKLVGRKDKAKLEKEVTELMDMVGIAPRLINSYPHELDGGRRQRVG
FT                   IARVLALRPQFIVCDEPVSALDVSIQAQVLNLMQDLQEEFGFTYLFITHDLSVVKHLSN
FT                   EILVMYLGKMVEKAPASALFANPLHPYTQALLSAIPVPDPDFPVSRILLEGELTSPIDP
FT                   KPGCRFARRCPKATEACLKGDIPFIEVEPNHFAACIMIGKT"
     atggcagaaa aacaggagat cctgagagtc gagcatctga agaaatactt tgataccccc        60
     tcggggtcgc ttcatgcggt tgatgacctt tccttttcca tcaacaaggg agagaccctc       120
     ggagtagtcg gcgaatcggg ctgtggtaaa tcgaccctcg gcagaaccat ccttcggctt       180
     cacgaaccga caagcgggaa catttggttc gaaggccggg aaattaacag ttgcaacaaa       240
     cgggagatga aaaatctgcg taagcatatg cagatcattt ttcaggaccc ctttgcctct       300
     cttaaccccc gtatgaccgt gggagagacc atttccgaga gccttctcat ccagaagctt       360
     gttggaagga aagacaaggc caagctcgag aaagaggtaa cggaattgat ggatatggtg       420
     ggtattgccc ccaggctcat caacagctat ccccacgagc tggatggcgg caggcgacag       480
     cgggttggaa ttgcccgggt acttgccctc aggccgcagt ttatcgtgtg tgatgagccg       540
     gtgtccgccc ttgatgtctc gattcaggca caggtactca acctgatgca ggatcttcag       600
     gaggaattcg gctttaccta cctgttcatt acccacgatc tttcggtggt gaagcatctt       660
     tccaatgaga ttttggttat gtatctggga aagatggtgg aaaaagcccc ggcttccgcg       720
     ctttttgcca atccgctcca tccctataca caggccctgc tatcggccat tcccgttcct       780
     gatccagatt ttccagtcag ccgtatctta ctggaagggg aattgacaag ccctatcgat       840
     ccaaaaccgg ggtgccggtt tgcgcgacgc tgccctaagg caacggaggc gtgcctgaag       900
     ggggatattc cctttattga ggttgagccg aaccactttg cggcttgcat catgattggt       960
     aagacttga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page