(data stored in ACNUC7421 zone)

EMBL: CP002116.PE290

CP002116.PE290       Location/Qualifiers
FT   CDS_pept        complement(304717..305328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0294"
FT                   /product="flavoprotein WrbA"
FT                   /note="COGs: COG0655 Multimeric flavodoxin WrbA; InterPro
FT                   IPR010089:IPR008254; KEGG: geo:Geob_3294 TrpR binding
FT                   protein WrbA; PFAM: flavodoxin/nitric oxide synthase; SPTR:
FT                   Flavoprotein wrbA; TIGRFAM: flavoprotein WrbA; PFAM:
FT                   NADPH-dependent FMN reductase; TIGRFAM: NAD(P)H:quinone
FT                   oxidoreductase, type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79450"
FT                   /db_xref="GOA:E1RAF9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAF9"
FT                   /protein_id="ADK79450.1"
FT                   /translation="MKIAVVFYSMYGHMHAMAEAALEGAVTVPGTEGGLYRFPETLDPK
FT                   VLEMLGATEVQKKLSSIPEVTLDVIKDADGIIFGIPTRFGNMPGQARAFFDTTGQLWAQ
FT                   GALIGKVGSVMSSSSTQHGGQESTILTSIVTLMHHGMVIVGLPYSFQGQMTIDEISGSS
FT                   PYGASTITGGKGERMPSENELSAARFQGEYVAEIAKKLST"
     atgaaaatcg ccgttgtatt ttattcaatg tacggtcaca tgcatgccat ggcagaggca        60
     gccctggaag gagccgtaac cgtgccggga acagagggag gcctctatcg atttcccgaa       120
     acgcttgatc ccaaggttct ggagatgctg ggagctactg aagtacagaa aaaattgtcg       180
     tcgataccgg aagtgaccct tgatgtcatc aaagatgcgg acggtatcat tttcggcatt       240
     cccaccagat ttggaaacat gcctggccag gctcgcgctt tttttgatac gaccggtcag       300
     ctttgggccc agggagcttt gatcggtaag gttggtagtg tgatgtccag ctcgtctacc       360
     cagcacggtg gtcaggaaag cacaatcctc acctccatcg taacacttat gcaccacgga       420
     atggttattg ttgggctccc ctactcattc cagggacaaa tgaccataga cgaaatatca       480
     ggaagctctc cttatggagc ctcgacgatt accggaggaa agggggaacg catgcccagt       540
     gagaatgagc tgtcagcggc gcggttccaa ggggaatacg tggccgagat tgcaaaaaaa       600
     ctgagcacat aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page