(data stored in ACNUC7421 zone)

EMBL: CP002116.PE293

CP002116.PE293       Location/Qualifiers
FT   CDS_pept        complement(306741..307352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0297"
FT                   /product="ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /note="COGs: COG0293 23S rRNA methylase; InterPro
FT                   IPR002877:IPR016448; KEGG: tde:TDE1968 cell division
FT                   protein FtsJ; PFAM: ribosomal RNA methyltransferase
FT                   RrmJ/FtsJ; SPTR: Ribosomal RNA large subunit
FT                   methyltransferase E; manually curated; PFAM: FtsJ-like
FT                   methyltransferase; TIGRFAM: cell division protein FtsJ"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79453"
FT                   /db_xref="GOA:E1RAG2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAG2"
FT                   /protein_id="ADK79453.1"
FT                   /translation="MASNKRATADYYSQLAKKEGYPARSIYKLEEIEKRFGVINTELPI
FT                   LDVGAAPGSWSLFISRLIKAKGLQPTIVSVDLKEMTVSKKSGITVITGDAFAGDAYQSI
FT                   RGMGPYGTIVSDAAPATTGNRIVDTGRSFSLASSVITLAEELLAPGGNLVVKIFQGGDE
FT                   QELMEMVRSRFSQLKTLKPKACRKDSFETYLIGLRKKHNG"
     atagcttcaa ataagcgtgc aacagccgac tactacagcc agttggcaaa aaaagaggga        60
     tatcccgctc ggtcgatcta caagcttgaa gagatcgaga aacgttttgg ggtgatcaac       120
     acagaacttc ccatcctgga tgtcggagca gcacccggta gttggagtct cttcatttcc       180
     agattaatca aagctaaggg attacaaccg accattgttt ctgttgattt aaaagaaatg       240
     acggtctcaa aaaaaagcgg tatcaccgtc atcaccggag atgcctttgc gggagatgca       300
     taccaaagca ttcgaggcat gggcccctat ggtaccattg tctccgatgc ggctccggct       360
     acgaccggca accgtatcgt cgatacggga agatcgtttt cgcttgcatc atcggttatc       420
     acccttgcag aagaacttct cgccccgggt ggaaacctgg ttgttaagat tttccaggga       480
     ggagatgagc aagagttgat ggagatggtg cgcagccgct tttctcagct gaaaaccctc       540
     aagcctaaag cgtgtcgtaa agactctttt gagacctatt tgatcggact aaggaaaaaa       600
     cacaatgggt ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page