(data stored in ACNUC7421 zone)

EMBL: CP002116.PE3

CP002116.PE3         Location/Qualifiers
FT   CDS_pept        1768..2871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0003"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: tde:TDE0231 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta subunit, C-terminal domain; DNA
FT                   polymerase III beta subunit, N-terminal domain; DNA
FT                   polymerase III beta subunit, central domain; TIGRFAM: DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79163"
FT                   /db_xref="GOA:E1R6N1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N1"
FT                   /protein_id="ADK79163.1"
FT                   /translation="MKFTCEKNALLKEISIAQEIISTRNALSILSNVLLEADDGSLTIK
FT                   ATDLKVSFETRIPVEIAAPGSTTVFCDKFLGILRSLPEGDIEVELVDNRVMIRPLFQKI
FT                   NFQLKSIAGDKFPELQEVSEDLYFEIPQKDLIEMIGQTIFAVSDDETRYYMNGVYVEQD
FT                   GESISMVATDGRRLSLIKRRIESELKEFDAVIIPPKVLQLIRKLSSGEGNLKIAISDRN
FT                   IFVQFDDQRITSNLIEGQFPNYRRVIPDSQDYQLVVNRDQLEEALKRVSLLVEQKSRRV
FT                   YLSVENAMMRLTSEESDIGVAKEELSCSYEGPETTIALNYLYLAEPLKVMRCEEVVLRF
FT                   TEANKAITLEPVPEGDYFHIIMPMQLD"
     atgaaattta cctgcgaaaa aaacgcattg ttgaaagaaa tttccattgc ccaggaaatc        60
     atctctacaa gaaatgcact ttcaattctt tcaaacgtac ttctcgaagc cgacgatggg       120
     tctctgacca taaaagcgac agatttgaaa gtaagcttcg agaccagaat accagttgaa       180
     attgctgctc ccggaagtac tacggtcttt tgtgacaaat ttttgggaat tcttcgttcc       240
     ctaccggaag gagatatcga ggttgaactg gtcgacaaca gagtcatgat acgacccctc       300
     tttcagaaga tcaactttca acttaagagt attgccggag acaaattccc cgaattgcag       360
     gaagtatccg aagatcttta ttttgagatc cctcaaaagg atcttattga gatgatcggc       420
     cagacaatct ttgctgtttc cgatgatgag actcgttatt acatgaacgg agtctatgtg       480
     gagcaggacg gtgaaagtat ttccatggtg gctaccgacg ggagaaggct ttcccttatc       540
     aaacggcgaa tagaatccga attgaaggaa ttcgacgccg tgatcattcc tccgaaggtt       600
     cttcagctta tcagaaagct ttcatcagga gagggaaatc tgaaaattgc tatttccgac       660
     cggaatatat tcgttcagtt tgatgatcaa cggattacca gcaacctcat tgaaggacaa       720
     tttcccaatt atcggcgggt cattcccgac agtcaggatt accagttggt tgtcaaccgt       780
     gatcagcttg aagaggctct taaacgtgta tcgcttttgg ttgagcagaa atcaagaagg       840
     gtctatctca gtgttgagaa cgcaatgatg cgacttacca gtgaagagag tgatattggt       900
     gtcgccaagg aagaactttc ctgtagttat gagggacctg agaccaccat agcgttgaat       960
     tatctttacc ttgccgaacc cttgaaggtt atgcgctgtg aagaagtcgt tcttcgtttt      1020
     actgaagcaa ataaggcgat caccctcgaa ccggttcctg aaggcgatta tttccatatc      1080
     attatgccga tgcagctgga ttaa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page