(data stored in ACNUC7421 zone)

EMBL: CP002116.PE30

CP002116.PE30        Location/Qualifiers
FT   CDS_pept        26872..27633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0030"
FT                   /product="Creatininase"
FT                   /note="COGs: COG1402 Uncharacterized protein putative
FT                   amidase; InterPro IPR003785:IPR019775; KEGG: aco:Amico_0022
FT                   creatininase; PFAM: Creatininase; SPTR: Putative
FT                   uncharacterized protein; PFAM: Creatinine amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79190"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q8"
FT                   /protein_id="ADK79190.1"
FT                   /translation="MLLSEMTWPQAEKYFKESDLVIIPIGSIECHGKHMPLGTDTLIPD
FT                   KIIELLRRQEDRFLIAPTIPYGACESLYPFPGTVNLGTDLLYELMKTIVENLKRHGAKK
FT                   FVVLNGHGGNIKALERIGYELDADGCLMAILNWWLNVWEMNPEWKGGHGGGEETAAVMA
FT                   IDPDLVDRSYIDLPLEITDLSDTIKGSGFNTVQYDNITVTIPRLTNHVTSNGWIGPDHP
FT                   KYATVEWGSEMLQTFTNFMVSFLKEFEKVEL"
     atgttgttat ctgaaatgac ttggccgcaa gccgagaagt atttcaagga atcggattta        60
     gtcattattc ccatcggaag tatcgaatgc catggaaagc atatgccttt ggggaccgat       120
     actcttattc cggacaaaat catcgaactt ttgcgtaggc aggaggaccg atttcttatt       180
     gcgccgacca ttccttacgg tgcctgtgaa agcttgtacc ccttccctgg gaccgtcaac       240
     ctgggaacgg atcttctgta cgagctgatg aaaacgattg tggaaaatct gaaacgacac       300
     ggagcaaaga aattcgttgt gctgaatggg cacggtggaa atattaaggc gctggaacgt       360
     atcggctacg agttggatgc ggatggctgt ctcatggcga ttctcaattg gtggctcaat       420
     gtttgggaga tgaaccccga atggaagggc gggcacggcg gtggtgagga aacggcagcc       480
     gttatggcca ttgatcccga cctggtcgac cgctcttata tcgatttacc ccttgaaatc       540
     accgatctct ccgataccat caagggatcc ggtttcaata cggtgcagta cgacaatatc       600
     accgttacga ttccgaggct gaccaatcac gtaaccagca acggctggat cggacctgat       660
     catcccaaat atgccaccgt cgagtggggg agcgagatgc tccaaacctt tacaaacttc       720
     atggtttcct tcctgaagga attcgagaag gtggaactgt ag                          762
//

If you have problems or comments...

PBIL Back to PBIL home page