(data stored in ACNUC7421 zone)

EMBL: CP002116.PE301

CP002116.PE301       Location/Qualifiers
FT   CDS_pept        complement(314737..315393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0305"
FT                   /product="Orotidine 5'-phosphate decarboxylase"
FT                   /note="COGs: COG0269 3-hexulose-6-phosphate synthase and
FT                   related protein; InterPro IPR001754; KEGG: spe:Spro_3937
FT                   3-keto-L-gulonate-6-phosphate decarboxylase; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase; SPTR:
FT                   3-keto-L-gulonate-6-phosphate decarboxylase ulaD; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase / HUMPS family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79461"
FT                   /db_xref="GOA:E1RAH0"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAH0"
FT                   /protein_id="ADK79461.1"
FT                   /translation="MNRPLLQIALDHTDLKAALESAGKVAEEVDVIEAGTILCYAEGAK
FT                   AVKQIHGAYPDHTIVADLKAADAGEVVANLVFSRGANWMTCICNAPLATMEAAKKVADT
FT                   YSGEIQVELYGAWSFDLAAKWLDIGIHQAIYHRGRDAAAAGQNWSDEDIQKIRHLGKMG
FT                   FAVSVTGGLAPQDLSLFRGIPVKCFISGRSLYEAKDPIAAARAFKQAIRDNWNQE"
     atgaacagac cattactaca aattgccctg gaccacacag atttgaaggc agctcttgaa        60
     tcggcaggaa aggttgcaga agaagtagac gttattgaag caggaacgat cctttgctat       120
     gccgaagggg ctaaagcagt aaaacagata cacggtgcat atcccgatca taccatcgtt       180
     gccgacctga aggcggcgga tgccggagaa gtggtagcaa atttggtgtt ttcccgggga       240
     gcaaactgga tgacatgcat ctgcaatgct ccactggcca caatggaggc ggccaaaaaa       300
     gttgcggaca catacagcgg cgagatacag gtggagctat acggagcgtg gtcattcgat       360
     ctggccgcaa aatggctcga tatcggcatc caccaggcga tctaccaccg ggggcgcgac       420
     gctgcggcgg ccggacaaaa ctggagcgat gaggatatac agaagatccg gcatctggga       480
     aaaatgggtt ttgcagtttc ggttacagga ggacttgcac cgcaggatct atcactgttt       540
     cgggggattc cggtgaaatg ctttatttcg ggtcgatcgc tttacgaggc gaaagatccc       600
     atagccgcgg cccgtgcctt caaacaggcg attcgggata attggaacca ggaatga          657
//

If you have problems or comments...

PBIL Back to PBIL home page