(data stored in ACNUC7421 zone)

EMBL: CP002116.PE306

CP002116.PE306       Location/Qualifiers
FT   CDS_pept        320000..321142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG0407 Uroporphyrinogen-III decarboxylase;
FT                   InterPro IPR018039; KEGG: dsy:DSY4756 hypothetical protein;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79466"
FT                   /db_xref="GOA:E1RAH5"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAH5"
FT                   /protein_id="ADK79466.1"
FT                   /translation="MNSTERTFLALDHKEADRVPVDFGGHLISGIHIDAYRKLLEYLGM
FT                   RFDQLRIERYRQRTAVIDEAVHQLFHTDFRPLVPPVPQLVWSDDGSRETYRDEWGVGWE
FT                   RQKDDGDYFECRTPRFSEMPDEEMLRDVHWPDYSKPSRLAGLAHRARTICKEEKVPILD
FT                   LPLGLELFDAGFNLCGSANFYMMLALDPKAAEYIMDRQLEQQLAWWTQAFQSIPDLSLI
FT                   RIGDDLGAQDSMLISPEMYRNLVLPRHKKLFAGIKTASRGRAKIIMHSDGAILPVIPDL
FT                   IEAGIDCLNPVQYTVPGIDPVLLKKEFGKDITFWGGGIDTQSILPNASPSQVKEEVRRQ
FT                   IDILAPGGGFIFSQVHIIQKDVPPENIVAMFEAVRESGIY"
     atgaactcaa ctgaacggac ttttctggcg cttgatcata aagaggccga ccgcgtgcct        60
     gtcgattttg gcggtcatct tatctccggt attcatatcg atgcctatcg caagcttctt       120
     gaatacctcg gcatgcgttt tgaccagctt cggattgagc gatatcgtca gaggaccgcc       180
     gttatcgatg aagctgtcca tcaacttttc cataccgatt ttcgtcccct agttcccccg       240
     gttccccaac ttgtatggtc ggacgatggt tccagggaaa cgtatcgtga tgaatggggg       300
     gtgggttggg aacggcaaaa agacgatggt gattattttg aatgccgaac accgcgtttt       360
     tccgagatgc cggacgagga aatgcttcga gacgttcact ggccggatta ttcgaagcct       420
     tccagacttg ccggacttgc tcaccgtgcc cggacgatct gtaaagaaga gaaggtaccc       480
     attctcgacc ttccacttgg acttgagctt ttcgacgcag gattcaatct atgtggttct       540
     gcaaatttct atatgatgct tgccctggat ccaaaggcgg cggagtacat aatggaccgg       600
     cagcttgaac agcagcttgc ctggtggact caggcatttc agagcattcc cgatttgtcg       660
     ttgatccgca taggcgatga tcttggtgct caggattcga tgctgatctc acccgaaatg       720
     tatcggaatc ttgttctgcc ccggcacaaa aaactgtttg ccggaattaa aacagcttct       780
     cgggggcggg ctaaaattat tatgcattca gatggtgcaa tcctacctgt cattcccgat       840
     ttgatcgagg cgggaatcga ctgcctcaat cctgttcaat acacagtgcc cggtattgat       900
     cctgttttgt taaaaaaaga atttgggaaa gatattacct tttggggtgg cgggattgat       960
     actcagtcga ttctccccaa tgcttcgccc tcccaggtaa aagaggaggt gagacgtcaa      1020
     atcgatatcc ttgcacccgg tggcgggttt atttttagtc aggtgcatat tatccaaaaa      1080
     gatgttccac ccgagaatat tgtggcaatg ttcgaagccg tccgggagtc tggaatctat      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page