(data stored in ACNUC7421 zone)

EMBL: CP002116.PE307

CP002116.PE307       Location/Qualifiers
FT   CDS_pept        321241..322020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0311"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="COGs: COG1349 Transcriptional regulators of sugar
FT                   metabolism; InterPro IPR001034:IPR014036:IPR018356; KEGG:
FT                   pca:Pcar_0940 putative DeoR-type transcriptional regulator;
FT                   PFAM: regulatory protein DeoR; SMART: regulatory protein
FT                   DeoR; SPTR: Putative uncharacterized protein; PFAM:
FT                   Bacterial regulatory proteins, deoR family; DeoR-like
FT                   helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79467"
FT                   /db_xref="GOA:E1RAH6"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAH6"
FT                   /protein_id="ADK79467.1"
FT                   /translation="MSESSIVANRHLKLLDILNRKGFVRVDQLSMHLNVSQGTIRRDLE
FT                   YLSQKGLLERRHGGARIASSPLNSLPERDFMEKGLINTEEKKAIAKKALELVHDNDIIF
FT                   LNSGSTTLHFLEALRDARVRVFTNNAWAVSCKKGPELELMILGGEYREQSRSFIGIMTL
FT                   EAIKNINSNITFLGTNGISLEKGLTTAVHQECSINQAMIENTNGKVVVLADHSKIGRVS
FT                   NFVSTALNEIDILITDKSAPSETLEKFKHMGVDVIIA"
     atgtctgaaa gttccatcgt ggcaaaccga catctgaaat tgttggatat tctcaatcga        60
     aaggggtttg tgcgtgtcga tcaattgagc atgcacctta atgtttcgca gggaacgata       120
     cggcgtgact tggagtatct ttcacaaaag ggccttcttg aacggaggca tggaggggct       180
     cgcatagcct cttctccatt aaactccctt cccgaaagag atttcatgga aaaaggcctg       240
     atcaataccg aagaaaagaa ggccatagcc aaaaaagccc tcgagcttgt acatgacaat       300
     gatatcattt tcctgaacag tggttcgacg acactccatt ttttagaggc tctccgagat       360
     gctcgagtga gggtgtttac gaataatgct tgggcggtat cttgcaagaa aggcccagag       420
     cttgagctga tgattttagg gggagaatac agggaacaat cgagatcgtt tattggtatc       480
     atgaccctgg aagcaataaa gaacatcaac agcaatatca cttttctcgg aacgaacgga       540
     atcagtctcg aaaaaggtct gactacagct gttcatcagg aatgtagtat caaccaggca       600
     atgatcgaga atacgaatgg caaggtggtt gttttggctg atcactctaa aattgggcgc       660
     gtttcaaatt ttgtttcaac tgcactgaac gaaattgata ttcttatcac cgataaatct       720
     gctccctctg aaacacttga gaagtttaaa catatgggtg tagacgtgat tattgcctaa       780
//

If you have problems or comments...

PBIL Back to PBIL home page