(data stored in ACNUC7421 zone)

EMBL: CP002116.PE31

CP002116.PE31        Location/Qualifiers
FT   CDS_pept        27640..28716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0031"
FT                   /product="Glutamyl aminopeptidase"
FT                   /EC_number="3.4.11.7"
FT                   /note="COGs: COG1363 Cellulase M and related protein;
FT                   InterPro IPR008007; KEGG: efa:EF2724 M42 family peptidase;
FT                   PFAM: peptidase M42 family protein; PRIAM: Glutamyl
FT                   aminopeptidase; SPTR: Putative uncharacterized protein;
FT                   PFAM: M42 glutamyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79191"
FT                   /db_xref="GOA:E1R6Q9"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q9"
FT                   /protein_id="ADK79191.1"
FT                   /translation="MDKQASIRRIQRLSDANGISGFEDAVVELIRQEAEDLGNFSEDSL
FT                   RNLYLERSGNGKDRPVLLLDAHTDEVGFMVKAIRPDGMLEFITIGGWVPFNIPAHLVRV
FT                   RNRDGLYIPGVVASKPPHFLTEAERKAPLEVRDLVIDVGASSAEEIEHEYLIEIAAPVV
FT                   PDAHCSYDEVHDILMGKAFDNRLGCAAVVSAMEELRGDELPLNIVGAFASQEEVGTRGA
FT                   AVTAQRVTPDLAIVFEGCPADDTVVPAYQAQTVLKRGPMLRHIDARMITNPRFQRYALD
FT                   IAKREAIPVQRAVRTGGATNGAPIHLSNQGVPAIVVGIPVRYAHTHYGISSYSDFAHGV
FT                   ELAVKIIRNITHDIIAGF"
     atggacaaac aagcaagtat acggagaatt cagcgcctga gcgacgcaaa cggcatctcg        60
     ggattcgagg atgcggtggt agagcttatt aggcaagagg cagaggatct tgggaacttc       120
     agtgaagaca gcctccgcaa tctttatctg gaacgcagcg gcaacggaaa ggatagaccc       180
     gttctccttc ttgatgctca taccgatgag gtaggcttta tggtgaaggc gatcaggcct       240
     gacgggatgc tggagttcat taccatcgga gggtgggttc ctttcaatat ccctgcacat       300
     ttggtcaggg tacgtaacag agacggtctc tacatccccg gcgtggtcgc aagtaagcct       360
     ccccattttc tcaccgaagc ggagcgcaag gctcctctgg aggttaggga tctggttatt       420
     gacgtcggtg caagttcggc ggaagagatt gagcatgaat atctgataga gatagccgct       480
     ccggtggttc ctgatgccca ctgcagctac gatgaggtgc atgatatcct catgggcaag       540
     gccttcgaca accgcctcgg atgtgcggcc gttgtttccg ccatggaaga gctccggggg       600
     gatgagctgc cgcttaatat agtaggggcc tttgcttctc aggaagaggt cgggacccga       660
     ggggccgccg ttacggcaca gcgtgttact cccgatcttg cgatcgtttt tgaggggtgt       720
     cccgccgacg atacggtggt tcccgcttat caggcacaga ccgtgctgaa gcgcgggccg       780
     atgcttcgtc acatcgatgc ccgtatgatt acgaatcccc gctttcagcg ctacgcgctt       840
     gatatagcca agagggaggc tattcccgtg caacgcgccg ttaggaccgg tggtgcaacc       900
     aacggtgccc ctattcatct ttccaatcaa ggagttcccg ccattgttgt tggtattccc       960
     gttcgctatg cacataccca ttacgggata tcctcatata gcgacttcgc ccacggggtt      1020
     gagcttgcag tgaagatcat acggaatatt acacacgata ttattgctgg tttttga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page