(data stored in ACNUC7421 zone)

EMBL: CP002116.PE32

CP002116.PE32        Location/Qualifiers
FT   CDS_pept        28718..29767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_4032 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79192"
FT                   /db_xref="GOA:E1R6R0"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R0"
FT                   /protein_id="ADK79192.1"
FT                   /translation="MGIGRMFPLEAVGNKRQEYPASLGSDVCFCMSGRCAIYACLLDFL
FT                   PSDSRRVVYAPAYTCETVLASYLKAGYSCRFYDIDPEGLRPRFREEELDEVSLLSLCGY
FT                   YGVSTYDREFVRRCAERGIVIIHDTTHTPFQPDPAADYIAGSMRKWMGIACGGIAAKRK
FT                   GHFSISPLPVDPEHLAGRYASLELAGKAQKGDLHASSEASSVFWETELALRKSFDAYGS
FT                   DEQSRRILEYYPYDDMIARRRANYGLLLGLLGPPTGWAPVFPLLPENATPSHFSLYADD
FT                   REDLRSFLAQRDVATTVYWPIPPMIGDISSYPGAEWIYNHICSIQIDQRYGAEDMRLLA
FT                   SCLNAYSRI"
     atgggtattg gaaggatgtt tccactggaa gcggtgggca acaaacggca ggagtatcct        60
     gcttcccttg gttccgatgt gtgtttttgc atgtccggac gatgcgcaat ctatgcatgc       120
     ttactggatt ttttgccttc agatagccgg cgggtggtct acgcgccggc atatacctgc       180
     gaaacggtcc ttgctagcta cctgaaggcc ggctattcct gcaggtttta cgatattgat       240
     ccggaaggat tgcgaccccg gttccgcgaa gaagaacttg atgaagtttc gcttctttcc       300
     ctgtgcggat attacggtgt ttccacctat gatcgggaat tcgtgaggag atgcgccgaa       360
     cgcggcattg ttattataca cgacacgaca catactcctt ttcagccgga ccctgcggcg       420
     gattacattg cgggcagcat gcgaaagtgg atggggatag cctgtggagg aattgccgcg       480
     aaacgaaagg gacatttttc gatctccccc cttcctgtag atccagaaca tcttgccgga       540
     cgctacgctt cccttgagtt agccggaaaa gcacaaaagg gtgatttaca tgcgtcctcc       600
     gaggcttcat ccgttttctg ggagacggaa ctggctctca gaaaaagttt tgatgcctat       660
     ggcagcgatg aacaatctcg acgaattctc gaatactatc cctatgacga tatgattgca       720
     cgaagacggg caaactacgg ccttctgctg ggacttctcg gtcctccgac gggctgggca       780
     cctgttttcc cactcctgcc tgagaatgcg acaccaagcc atttttcact ttatgcggat       840
     gaccgggagg acctgcgttc ctttcttgcc cagcgggatg tcgctactac cgtctactgg       900
     cccattcccc cgatgattgg ggacatttct tcctaccccg gggcagagtg gatctataat       960
     catatctgct cgatccagat tgaccagcgc tacggcgccg aggatatgcg actgcttgct      1020
     tcctgtctta atgcgtacag caggatctga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page