(data stored in ACNUC7421 zone)

EMBL: CP002116.PE320

CP002116.PE320       Location/Qualifiers
FT   CDS_pept        334047..334322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0324"
FT                   /product="leader peptide processing enzyme"
FT                   /note="KEGG: oih:OB0617 leader peptide processing enzyme;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79480"
FT                   /db_xref="GOA:E1RAV0"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAV0"
FT                   /protein_id="ADK79480.1"
FT                   /translation="MNKKANTVIFILAASFLNIVIMIVLMLGLFALASLLLPADTGAGL
FT                   GQFIFLLIFAASVGGSFFIYHKLVGFISKKIDMEKYFHPIFRSRKR"
     atgaacaaga aagccaatac cgtgattttt atactcgccg catcatttct caatattgtc        60
     attatgattg ttctcatgct ggggcttttt gcccttgctt ctttactttt acctgccgat       120
     actggtgccg gtcttggaca gtttattttt ctccttattt ttgctgcgtc ggtgggcggg       180
     agttttttta tctaccacaa gttggtcggt tttatctcga aaaaaataga tatggaaaaa       240
     tatttccatc ccatctttcg gagccgtaag cgctag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page