(data stored in ACNUC7421 zone)

EMBL: CP002116.PE326

CP002116.PE326       Location/Qualifiers
FT   CDS_pept        339211..340458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0330"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="COGs: COG0204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; InterPro IPR002123; KEGG: mla:Mlab_0811
FT                   hypothetical protein; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase; SPTR: Phospholipid/glycerol
FT                   acyltransferase; PFAM: Acyltransferase; TIGRFAM:
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79486"
FT                   /db_xref="GOA:E1RAV6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAV6"
FT                   /protein_id="ADK79486.1"
FT                   /translation="MPNINKKQRHKTITPSPFFIKVIKPFLHWLLPRLYTIQVIRSKEL
FT                   NAIHPPYIIVGNHVNFWDPFLLGLYIKEVPQFVTSDNIFRTRLFGVIMKLFGSIPKSKF
FT                   MSDAATVAQIVRIIKGGGVIGIFPEGRRTWDGRSLEHVPQVSKLIQRLAIPVVGVRVKG
FT                   AFLARPRWARKRSKGLVELEYFSLFSGEELKGLGWEEVKQLMEKQLFHDDVAWAREKEL
FT                   RFVGKRRAEYVEKLLYLCPSCEGVATLVSHDNTVECSSCGYAFTYDETGELGPVTGPLR
FT                   FSELGDWNDWQQKRLIERICELPDGEQIFMEEGPAMLLTGYRAQRLKKLKTGRALFSRD
FT                   TLYFRTTLREGFSFPVNELEAVNVQDKEKLEFYHKGMLFRLNFVSSRASALLWYRAITG
FT                   VQECLASGNLLSSDKS"
     atgcctaaca tcaataagaa acaaagacat aaaactatca cgccaagtcc cttttttatc        60
     aaagtcataa agccttttct tcattggctt cttccgaggc tttataccat ccaggttatc       120
     cgttcgaagg agttgaacgc gatccatccc ccctatatca ttgtcggaaa tcatgtaaat       180
     ttctgggatc ccttcctgct ggggctctat atcaaagagg tgccccagtt cgttacttcg       240
     gataacatct ttcgcacacg cctttttggg gttatcatga agctgttcgg ttccatcccg       300
     aagtcgaaat ttatgagtga tgcggcaact gtagcccaaa tcgtgaggat catcaaaggc       360
     gggggcgtga tcggtatctt tcccgaggga cgtagaactt gggatggtcg tagccttgag       420
     catgttcctc aggtttccaa actgattcag cgattggcca tccctgtcgt aggggtaaga       480
     gtcaagggtg cttttctcgc ccgtccccga tgggcgagaa aaagaagcaa agggctcgtt       540
     gagttggaat acttttctct cttttctggt gaagagttga agggccttgg ttgggaagag       600
     gtaaaacagc ttatggaaaa acaacttttc catgacgatg ttgcctgggc tagagaaaaa       660
     gaactccggt ttgttggtaa acggcgtgcg gaatatgttg aaaaactctt atacctctgc       720
     ccctcctgtg aaggggttgc tacccttgtt tcccatgata ataccgtcga atgttcttcc       780
     tgtggctatg cctttaccta tgacgaaaca ggagagcttg gacctgtcac cggtcctctt       840
     cgtttttcgg aattgggtga ttggaacgat tggcaacaga aaaggctcat cgaacgaata       900
     tgtgaacttc ccgacggtga acaaattttt atggaagagg ggcctgccat gcttctcacc       960
     ggctatcggg cacagcgttt gaaaaagctc aaaacgggtc gtgctctctt ttccagagat      1020
     acactctatt ttcggactac cctacgtgag gggttttcct ttcccgttaa tgaacttgaa      1080
     gccgtcaatg tacaggacaa ggaaaaactc gaattttacc ataaaggaat gctctttcgt      1140
     ctcaattttg ttagtagccg agcctccgcc cttctttggt acagggcgat taccggggtt      1200
     caggagtgcc ttgcttccgg aaatcttctt tcgtccgata agtcctga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page