(data stored in ACNUC7421 zone)

EMBL: CP002116.PE337

CP002116.PE337       Location/Qualifiers
FT   CDS_pept        complement(349828..350754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0341"
FT                   /product="Hsp33 protein"
FT                   /note="COGs: COG1281 Disulfide bond chaperones of the HSP33
FT                   family; InterPro IPR000397; KEGG: dat:HRM2_11210 HslO;
FT                   PFAM: Hsp33 protein; SPTR: HslO; manually curated; PFAM:
FT                   Hsp33 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79497"
FT                   /db_xref="GOA:E1RAW7"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAW7"
FT                   /protein_id="ADK79497.1"
FT                   /translation="MIEKPIVGKTLSEHLKQLSKDTLDIFLLEEGSLRGAIAHGSMMVN
FT                   QMRANHDLGVLESYVLGQAYLAAGLLSSAVKGNDRLILSIECGGPIKGLSVETDAKAQV
FT                   RGYLAQVPIPVEKPLENFDLSPFFGPGFLKITKQLEHAKRPFPGQIMLRSGNLAEDLAW
FT                   YYLESEQTKSFFSLSIQFDNKGDIIGAGGLFLQELPGAKAEALEKVQETALAMPSLGTA
FT                   FSKGVSGSELVNRTLGKHSPQILGSRPLRFFCSCSKERFGAFLAGMQGLQQEEILKDSD
FT                   FPLRVECHNCGSVYEFSRVECEELFSN"
     atgatcgaaa aacctattgt gggaaaaacg ttatcggaac atctcaaaca actttctaag        60
     gatacccttg atatatttct tctggaagag ggctcgcttc gtggagccat cgcacatggc       120
     agtatgatgg tgaatcaaat gcgggccaat cacgaccttg gggttctgga aagctatgta       180
     ctcggtcaag cctaccttgc agcaggatta ctctcctccg cagtaaaggg aaacgacagg       240
     ctgatccttt ctattgaatg cggtggtccc atcaaggggc taagcgtaga aaccgacgca       300
     aaggcacaag tcagggggta tctggctcag gttcccattc cagtggaaaa acccctggaa       360
     aattttgatc tatcaccctt tttcggtcct ggttttctga aaatcacgaa gcagctggaa       420
     catgcaaaac gtccttttcc ggggcagatc atgttgcgaa gcgggaacct tgccgaagat       480
     ttggcctggt actatctcga atcggaacag acgaaaagct tcttttcatt gagcatccag       540
     ttcgacaaca aaggggacat tatcggcgcc ggaggccttt tccttcaaga acttcccgga       600
     gccaaagccg aagcactgga aaaggtacag gagacggctc tcgccatgcc gtcgctcgga       660
     accgcttttt caaagggagt aagcggttcc gagcttgtca atcggacact gggaaagcat       720
     tcgcctcaaa tccttggcag tcgtcctctc cgttttttct gtagctgctc gaaagaacga       780
     ttcggagctt ttcttgccgg aatgcaggga ctccagcagg aagagattct taaagattct       840
     gattttcccc ttcgggttga atgccataac tgcggttcgg tctatgagtt cagcagagta       900
     gaatgtgagg aactgttttc gaattaa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page