(data stored in ACNUC7421 zone)

EMBL: CP002116.PE34

CP002116.PE34        Location/Qualifiers
FT   CDS_pept        complement(31684..33150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0034"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /note="COGs: COG2195 Di- and tripeptidase; InterPro
FT                   IPR001160:IPR002933:IPR011650; KEGG: bfs:BF3079 putative
FT                   aminoacyl-histidine dipeptidase; PFAM: peptidase
FT                   dimerisation domain protein; peptidase M20; PRIAM: Xaa-His
FT                   dipeptidase; SPTR: Aminoacyl-histidine dipeptidase;
FT                   TIGRFAM: aminoacyl-histidine dipeptidase; PFAM: Peptidase
FT                   family M20/M25/M40; Peptidase dimerisation domain; TIGRFAM:
FT                   aminoacyl-histidine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79194"
FT                   /db_xref="GOA:E1R6R2"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R2"
FT                   /protein_id="ADK79194.1"
FT                   /translation="MNNNPLEGRKPASVWHYFQTISKIPRCSCNEAAVRDYVRQFAEEH
FT                   HMAWKIDAAGNIAVKKGASVGKEAHPGVVLQGHLDMVCEKNRTTKHDFTVDPIKLVVDG
FT                   DWLKADGTTLGADNGIAVAMALAVLASDEISHGPIEVLFTVDEETGLTGAMGLDPSIIE
FT                   GKILLNLDSEEPGVFYIGCAGGVNTEGMLPITSEAVPQGRVCYTLTIEGLQGGHSGGEI
FT                   HLGRGNAIDLVGRLLWELRKLGDFNLVSINGGGKHNAIPRECHARFTLSKEKVAEAEKL
FT                   AKTIGREIKAELGDNAPGFNLIFEKDTEADEQFDPSSTDRICYMLRIMPHGVAAMSRSI
FT                   EGLVETSTNFAAIETQKDCCSTTVKVLTSQRSSIMSALDDIAAKVNAAICVVGGQVRHY
FT                   SRYPAWTPNPNSKLLAECKRIYRDFTGEEAVHAAIHAGLECGVIGDKLEGMEMISFGPE
FT                   MLGVHTPEERLNIPSVEKLWGFLIKLLENV"
     atgaataata accctttgga gggaagaaaa cccgcttcgg tctggcatta ttttcagacc        60
     atcagcaaga ttccccgttg ctcatgcaac gaggcagcgg ttcgtgatta tgtccggcaa       120
     ttcgcagaag agcatcatat ggcctggaaa atcgatgcgg cgggcaatat tgcggtaaag       180
     aagggtgctt ctgtcggtaa ggaggcccat cccggagtag tcctccaggg ccacctcgat       240
     atggtatgcg aaaaaaatcg tacgaccaag catgatttta ccgttgatcc tatcaaactt       300
     gtagtcgacg gcgactggct caaagccgac ggaacgaccc tgggagccga caacggcatt       360
     gcggttgcca tggccctggc agtccttgca tctgatgaaa tcagccacgg tcctattgaa       420
     gtactcttta ccgttgacga ggaaacgggc ttaaccgggg caatgggtct tgatccctcc       480
     ataatcgaag gaaaaatcct tctcaacctc gactcggagg aaccgggggt cttttacatc       540
     ggctgtgcgg gaggtgtcaa caccgaggga atgttgccga ttacaagcga ggcagtaccc       600
     caagggcgtg tctgctatac gttgacgatt gaagggctcc aaggtggaca ttcgggaggc       660
     gaaatccatc tcggtcgtgg caatgccatc gacctcgttg gcaggctgct ctgggaactg       720
     cggaagttgg gagatttcaa tctcgtttcc atcaacggag ggggaaaaca taatgccatc       780
     cccagagaat gtcatgcccg tttcaccctt tcaaaggaaa aagtcgccga agcagagaag       840
     ctggcgaaaa caatcggaag agagatcaaa gcggaattgg gcgataacgc accgggattc       900
     aacctcatct ttgaaaagga taccgaagcc gacgaacagt tcgacccttc gtctacagac       960
     cgaatatgct atatgctgcg tatcatgccc cacggagtgg cggcaatgag ccggagtatt      1020
     gagggcctgg tcgaaacaag taccaacttt gcagcaatcg aaacccaaaa ggattgctgt      1080
     agtacgacgg tgaaggtctt aacaagtcag cgatcctcga tcatgagtgc tcttgacgac      1140
     atagctgcaa aggtgaatgc tgcaatatgt gtcgtaggcg gtcaggtgcg ccactattca      1200
     cgctatcctg cctggacgcc caatccgaac agtaaactcc ttgccgaatg taaacgaatc      1260
     taccgagatt ttaccggtga agaagccgtc catgccgcca tccatgcggg gttggaatgc      1320
     ggtgtcatcg gcgataaact ggagggtatg gaaatgatat cctttgggcc ggaaatgctg      1380
     ggggtgcata ctccggaaga acggctcaat attccctcgg tggaaaagct ttggggcttt      1440
     cttatcaaat tgctggaaaa cgtataa                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page