(data stored in ACNUC7421 zone)

EMBL: CP002116.PE341

CP002116.PE341       Location/Qualifiers
FT   CDS_pept        353653..354912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0345"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG4177 ABC-type branched-chain amino acid
FT                   transport system permease component; InterPro IPR001851;
FT                   KEGG: dat:HRM2_02770 LivM1; PFAM: inner-membrane
FT                   translocator; SPTR: LivM1; PFAM: Branched-chain amino acid
FT                   transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79501"
FT                   /db_xref="GOA:E1RAX1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAX1"
FT                   /protein_id="ADK79501.1"
FT                   /translation="MTKINLWKEAKTSLIIALWFVILTFPIMVIKVNTIDDIVEWRWIR
FT                   ILFVGIGAFFLSAAYRYMLYRKKTGARREAKARVLKIPRLGINTTLDAAFFSQKKVALP
FT                   GILFIALAIIILPFISSMYQTNIISTALLSVMLGMGLNIVVGLGGMLHLGYIAFYAVGA
FT                   YTYALLNYHFGVNFWVALPLGGLFSMIFGILLGIPVLRLKGDYLAIVTLGFGEIIRIVL
FT                   ENWNEFSFGPSGIANIPRPGFFGVKLSIQHASIFTYFILIALVIFTIFIVSRLKNSRLG
FT                   RAWEAMREDDIACEAMGVDITKAKMTAFALGAFWAGLAGVVFASKTTFINPASFTMWES
FT                   IVVLCIVVLGGMGSLGGVVIGALLIVLLPEYLRAFSEYRMLLFGAVLVVMMIFRPEGLI
FT                   QARRHVFTFEHGENKSEAEK"
     atgacaaaga ttaatctctg gaaagaggcg aaaacctctc ttattatagc cctttggttt        60
     gtgatcctca cctttccgat tatggtgatc aaggtcaata ccattgatga tattgttgag       120
     tggcgatgga ttcggatatt gtttgtcggc atcggtgcct ttttcctttc cgctgcctat       180
     cgctacatgc tctatcgaaa gaaaaccggg gcaagaagag aagcgaaggc acgggttctc       240
     aagataccta ggcttggaat taatacgacg ctggatgcgg cattcttttc acagaaaaag       300
     gttgcactcc cgggcatact cttcattgcc cttgcgatta ttattcttcc ctttatttcc       360
     tcaatgtacc aaaccaatat tatttccacc gccttgctct ccgtgatgct cggtatggga       420
     ttgaatatcg tagttggctt gggagggatg ctgcatcttg gctacatagc cttttatgcc       480
     gtaggagcct acacctatgc cctgctgaac tatcatttcg gcgtcaattt ttgggtggcc       540
     cttcccctcg gcggcttatt cagcatgatc ttcggtattc tcctcggtat tcccgtttta       600
     cgcttgaaag gtgattacct tgccatcgta acccttggtt tcggagagat catcaggata       660
     gtccttgaga actggaacga attttcattc ggacccagcg ggatcgccaa tataccgcga       720
     ccgggatttt tcggggtgaa gttgtcgatt cagcacgcat cgatttttac ctattttatt       780
     cttattgctc tggttatttt taccatcttc attgtatcaa gattaaaaaa ctccaggctc       840
     ggcagggcgt gggaagcgat gcgggaggat gatattgcct gtgaagcgat gggggtcgat       900
     atcaccaagg ccaagatgac ggcctttgcc ctcggtgcct tttgggccgg gcttgccggt       960
     gttgtgtttg cgtcaaagac aacctttatt aatcccgcca gttttaccat gtgggaatcg      1020
     atcgttgtgc tttgtattgt ggttctcggc ggcatggggt ctctcggcgg ggttgttatc      1080
     ggagcactgc tcattgtttt gcttcccgag tatcttcgtg ccttctccga atacagaatg      1140
     ctgctttttg gtgccgttct tgttgtcatg atgatttttc ggcccgaagg tcttatacaa      1200
     gctcgtcgtc acgtttttac ctttgaacac ggtgagaaca aaagtgaggc tgaaaaatga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page