(data stored in ACNUC7421 zone)

EMBL: CP002116.PE349

CP002116.PE349       Location/Qualifiers
FT   CDS_pept        361643..362152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0353"
FT                   /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /note="COGs: COG1905 NADH:ubiquinone oxidoreductase 24 kD
FT                   subunit; InterPro IPR002023; KEGG: dma:DMR_07850 putative
FT                   NAD-reducing hydrogenase subunit; PFAM: NADH dehydrogenase
FT                   (ubiquinone) 24 kDa subunit; SPTR: Putative NAD-reducing
FT                   hydrogenase subunit; PFAM: Respiratory-chain NADH
FT                   dehydrogenase 24 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79509"
FT                   /db_xref="GOA:E1RAX9"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAX9"
FT                   /protein_id="ADK79509.1"
FT                   /translation="MNALTGDRTEAASFGVVCRILDLYDRDPGMIIPILQKVQEEYRYL
FT                   PEEVLLFLATSLEISPARLYGIATFYSHFSLEPKGKHVIKVCDGTACHVKGSGALIETL
FT                   RSMLALEKGIKTTSDMLFTLETVSCLGACGLAPVVVIDDTVHGQMTPDKVRALITKIRE
FT                   EEDAEA"
     atgaacgccc taaccggaga tagaaccgaa gcagccagtt ttggagtcgt atgtcggatt        60
     cttgatctct acgaccggga tccgggaatg atcataccaa ttcttcaaaa ggtacaggag       120
     gagtatcgct accttcccga agaggtgctg ctttttttgg cgacgagtct ggaaatttct       180
     ccggcccgtc tttacggtat cgctaccttt tacagccatt tttctctgga gccgaaggga       240
     aagcatgtaa tcaaggtatg cgacggaacc gcttgtcatg tgaagggctc cggggcgctg       300
     atcgaaaccc ttcgttcaat gcttgctctt gagaagggaa taaaaaccac ttcggacatg       360
     ctgttcaccc ttgagacggt gtcctgcctg ggtgcgtgtg gtttagcacc tgtggttgtg       420
     atagatgata cggttcatgg acaaatgact ccagataagg ttcgcgctct catcacgaag       480
     atacgggagg aagaagatgc tgaagcttaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page