(data stored in ACNUC7421 zone)

EMBL: CP002116.PE35

CP002116.PE35        Location/Qualifiers
FT   CDS_pept        33396..34613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0035"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647; KEGG: reh:H16_B0715 TetR/AcrR
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   TetR; SPTR: Transcriptional regulator, TetR/AcrR-family;
FT                   PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79195"
FT                   /db_xref="GOA:E1R6R3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R3"
FT                   /protein_id="ADK79195.1"
FT                   /translation="MTDKQKRRREEIIETAFRVWSESSFKKTSLSAVATRMGISKTALY
FT                   RYFSGKEALLQAMEEYFLRLYNHLCDEVIRHRDERSVAEALEAYNRIFVGFFARNSHYL
FT                   RFAQIRFIRKPQVGDSFLAMTFRRNMDLFPAEPLAREFGWRMAQIPVIVRYILSVSNFL
FT                   LAVEHCGNEEIAGGAESLLEVNRRLIISGISLNRDRQIPDFQMIEERCILSEGDFPETD
FT                   RVTYAVSEVVAENGLWNTTVEKIAHRLGMSKSSLYFYFENRDEMLWKLIEQERQAFGAL
FT                   VIRDIEPMESFSDQLYAYFVLHARYLWGRPEFLATMNWYRFQDIAFHPPEDPISSVIRF
FT                   YRFVEEAVEAGVMSEKVPLLSFLRLLNFLLMQELSEHFRRGNDFNQLFPILRTLHQLLL
FT                   YGVQGA"
     atgacagata agcagaaacg aagaagagaa gagatcatcg aaactgcatt tcgggtgtgg        60
     tcggagagct cgtttaaaaa gaccagcctc tcagccgttg caacgcgtat gggaataagc       120
     aaaacagcgt tgtatcgcta cttttcggga aaagaggcgt tgcttcaggc catggaagag       180
     tattttcttc gtttgtacaa ccacttatgt gatgaagtga tcaggcatcg agacgaaagg       240
     agtgttgcag aggccctgga ggcgtataac cgcatttttg taggtttttt tgcgcggaat       300
     tctcattacc tccggtttgc tcagattcgc tttatcagaa agccccaagt cggggattcc       360
     tttctggcca tgacctttcg gagaaatatg gatctttttc ctgctgagcc tcttgcaagg       420
     gaattcggct ggagaatggc gcagataccg gttatcgttc gttatatact gtcggtttcg       480
     aattttcttc ttgccgtcga acactgtgga aacgaagaaa tagcgggggg tgctgagagc       540
     cttctggaag taaatcgccg cttgattatc tcgggtatca gcttgaaccg tgatcgtcag       600
     atacccgatt ttcagatgat cgaggagcga tgtatccttt ccgaggggga ttttcccgaa       660
     accgatcggg tgacttatgc cgtaagcgag gtggttgctg agaatggtct ttggaatacc       720
     acggtggaaa aaatcgcgca tcggctgggg atgagtaaaa gtagtcttta cttttacttc       780
     gagaatcgtg acgagatgct gtggaaattg attgagcagg agcggcaggc ttttggcgcg       840
     ttggtcatta gggatattga accaatggag tccttttccg atcagctcta tgcttatttt       900
     gtattgcatg cgcgctattt gtggggacgg ccggagtttt tagcaacgat gaactggtat       960
     cgcttccagg atatcgcttt ccatccccct gaggatccga tctccagcgt gatcagattt      1020
     tatcgatttg tcgaagaggc agttgaagcg ggcgttatgt cggagaaggt ccctttgctc      1080
     agttttcttc gtcttttaaa ttttttgctg atgcaggagc tttccgaaca ttttcgacgc      1140
     ggtaatgatt ttaatcagct ttttccgatc ctgcggacgc tgcaccaact tttgctgtat      1200
     ggagtacaag gagcgtaa                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page