(data stored in ACNUC7421 zone)

EMBL: CP002116.PE350

CP002116.PE350       Location/Qualifiers
FT   CDS_pept        362139..364037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0354"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.5.11"
FT                   /note="COGs: COG1894 NADH:ubiquinone oxidoreductase
FT                   NADH-binding (51 kD) subunit;
FT                   InterProIPR011538:IPR019554:IPR019575:IPR001450:IPR
FT                   017896:IPR017900:IPR001949; KEGG: dma:DMR_07840 putative
FT                   NAD-reducing hydrogenase subunit; PFAM: Respiratory-chain
FT                   NADH dehydrogenase domain 51 kDa subunit; Soluble ligand
FT                   binding domain; NADH ubiquinone oxidoreductase, F subunit,
FT                   iron sulphur binding; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; PRIAM: NADH dehydrogenase (quinone); SPTR:
FT                   NADH dehydrogenase (Quinone); PFAM: NADH-ubiquinone
FT                   oxidoreductase-F iron-sulfur binding region; 4Fe-4S binding
FT                   domain; Respiratory-chain NADH dehydrogenase 24 Kd subunit;
FT                   Respiratory-chain NADH dehydrogenase 51 Kd subunit; SLBB
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79510"
FT                   /db_xref="GOA:E1RAY0"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAY0"
FT                   /protein_id="ADK79510.1"
FT                   /translation="MLKLNLEAVGTAYDHTVSSLRMRIIICAGTGCLAGGSLNIFHAFK
FT                   AEAQKHGVPLHVELKQEDNPEFLLSKSGCQGFCQVGPLVTIEPAGILYTKVTAEDVPEI
FT                   FETTILSGKTVERLLYVNPADGKRCSGPSDIPFYVRQSRSVLASCGLIDPENIREYIYG
FT                   GGYRAAMEAYTAHTPEELCTIFTDSGLRGRGGGGFPSGKKWALTLRQQADKKYLICNGD
FT                   EGDPGAFMDRSILEGNPHSVVEGMMIAARAIGAEAGYVYVRAEYPLAVERIRKAIDAAR
FT                   ELGLLGEDLFGTGACFDIKVMEGAGAFVCGEASAMVASIMGGRGMPRPKPPRTAEKGLW
FT                   DKPTVVNNVETLATVPLVLRKGSKGYRTVGTSGSPGTKTFALTGHVANTGLIEVPFGTT
FT                   LREIIFEIGGGVLDEKGNVDNDAFKAVQIGGPSGGCLTREHLDIPLDFDSLGGIGAMVG
FT                   SGGLVVMNRSTCMVQVARFFMQFTQAESCGKCVPCREGTRQMLDLLDDIIEGRADESTI
FT                   PLLESLCRTVARGSLCGLGKAAPSPVLSTLRYFRQEYESHVVDKRCPVGACKALSDFVI
FT                   DESLCKGCTACAKACPVGAISGEKKAPHTIDTERCIRCGACMATCRFGAIRRGGAA"
     atgctgaagc ttaatcttga agcggtcgga accgcttacg accatactgt ttcttcactg        60
     cggatgagaa tcatcatctg tgccggtacc ggttgtctgg cagggggaag tttgaatata       120
     ttccatgcct ttaaagcgga agcccagaaa cacggggttc cgcttcatgt tgaattgaag       180
     caggaagata atcccgagtt tcttctttca aaaagcggct gccaggggtt ttgtcaggta       240
     ggcccccttg ttaccatcga accggccggt atcctctata caaaagttac tgccgaagat       300
     gtccctgaaa tctttgaaac aaccatcctt tcggggaaaa cagtggaacg cttgctctat       360
     gtcaatcctg ccgatggaaa gcggtgtagc ggtccctcgg atattccctt ctatgttcgc       420
     cagtccagga gcgtccttgc ttcctgcggg cttatcgacc ccgaaaatat tcgcgaatat       480
     atctacggtg gtggttaccg tgccgccatg gaggcctaca cagcccatac acccgaggag       540
     ttgtgtacga ttttcaccga ctcaggtctc agagggcgcg ggggcggcgg ttttcccagc       600
     ggaaaaaaat gggctttgac ccttcgccag caagcggata aaaagtatct aatctgcaac       660
     ggcgacgagg gggatcccgg agccttcatg gaccgatcca tccttgaggg gaatcctcat       720
     tcggtggtcg aagggatgat gatagccgcc agggccatcg gtgccgaggc agggtatgtc       780
     tatgttcgtg ccgaataccc cttggcggta gagcgaattc gcaaggctat tgatgccgcg       840
     agagagctcg gcctgcttgg agaggatctc tttggaacag gtgcctgttt cgacatcaag       900
     gtgatggagg gggcaggggc cttcgtttgt ggtgaggcaa gcgccatggt tgcaagcatc       960
     atggggggca ggggcatgcc ccgcccaaaa cctcccagaa cggcggaaaa agggctttgg      1020
     gacaagccga cggtggttaa caatgtggag acccttgcaa ccgttcctct tgtgcttcga      1080
     aaaggatcaa agggctatcg aacggtcggt acctcgggga gtccggggac caaaaccttt      1140
     gcccttaccg gccatgttgc caataccggg ctcatcgagg tcccctttgg tacgaccctc      1200
     agggagatca tcttcgaaat cggtggcggt gttctcgatg aaaaaggaaa tgtggacaat      1260
     gatgccttca aggctgttca gatcggggga ccctccggcg gatgtcttac cagagaacat      1320
     ctcgacatcc cccttgattt tgattctctg ggaggtattg gtgcaatggt gggaagcggc      1380
     ggacttgtgg tgatgaaccg ttcgacttgt atggttcagg ttgcccgatt tttcatgcaa      1440
     tttacccagg cagagagctg cggcaaatgt gtgccctgtc gggaaggtac caggcagatg      1500
     ctggatcttc tcgacgacat tatcgagggg agggcggacg aatccaccat tcccctcctc      1560
     gagtcgctct gcagaaccgt tgccagggga agcctgtgcg gacttggaaa agcggcccca      1620
     tcgccggttc tttctaccct ccgctatttt cggcaggagt atgaaagcca tgttgttgat      1680
     aagcgttgtc cggtgggggc ctgcaaggct ctgtccgact ttgtcatcga cgaatcatta      1740
     tgtaaaggat gcaccgcatg cgcaaaggcg tgtcccgttg gagcgatttc aggagaaaaa      1800
     aaggctcccc acactatcga tactgagcgc tgtatcaggt gcggcgcctg tatggccacg      1860
     tgccgcttcg gtgcgatcag aagaggaggt gcggcgtga                             1899
//

If you have problems or comments...

PBIL Back to PBIL home page