(data stored in ACNUC7421 zone)

EMBL: CP002116.PE36

CP002116.PE36        Location/Qualifiers
FT   CDS_pept        34617..36143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0036"
FT                   /product="outer membrane efflux protein"
FT                   /note="COGs: COG1538 Outer membrane protein; InterPro
FT                   IPR003423; KEGG: bga:BG0143 hypothetical protein; PFAM:
FT                   outer membrane efflux protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Outer membrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79196"
FT                   /db_xref="GOA:E1R6R4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R4"
FT                   /protein_id="ADK79196.1"
FT                   /translation="MKHAWFLLCAAMLFPAALFAGGSRESGTDTDFSSLDELKEFATPS
FT                   LDENAIERAVNSQAPADIADGAGEAALLSRERMRQKEELTVDVEKAVGLAREYNLSLKS
FT                   SQLGLVKKRRALSTVWNSFLPTLQVSTTLKRMNEAPTSFDFTTFSAYELSRWNQSFGVD
FT                   ANLYLNLALFDGITATRLNYESGLVDYEQARKQLERDVRKNFYNLLLMQQNRDLFVQQI
FT                   AAAKDRYDQARINYQNGLVPELTMLSARVAWENLKPTLESMDLSYDQALSGFKMTLGLS
FT                   QDTELHLDGEISADPIALEADPLIDQYLTGRLDIKSLLYNLKNLDVQRRATISQAFTPG
FT                   LTVGWSYDPTMNDPFGGDYFNSDSWDQQSGMFRITVAMNLEGFLPGSKTKVELAGIEDD
FT                   KRSLRLSLMQAIEGAEMEIDSLVKQLNHSKNSMDSLKLNIELADQAYRMAEEAYRAGSR
FT                   ELLEVQNAEIELNNAKYELLKEKYNYVTGLLDLEYALNTTLDKIKEGNDE"
     atgaaacatg cttggttctt gctatgcgcg gcgatgttgt ttcccgccgc tctgtttgcc        60
     ggcggaagcc gggaaagcgg gactgatacg gatttttctt ctcttgacga attgaaagag       120
     tttgcaaccc cctctttgga tgagaacgcg atagaacggg cggtgaactc gcaagctcct       180
     gcggatatcg cagacggagc aggtgaggct gcattgcttt ccagggaacg catgcggcag       240
     aaggaggagt tgaccgttga tgtggagaag gcggtaggtc tggcacggga atacaacctg       300
     agtctgaagt ccagccagct tggtcttgtt aagaagcgcc gggccctgag cacggtctgg       360
     aacagttttc ttccgacgtt acaggtttca acgacgctga agaggatgaa tgaggcacca       420
     accagttttg attttactac cttttcggcc tatgagcttt cccgctggaa tcagagcttc       480
     ggagtcgatg cgaatcttta tttgaatctg gcacttttcg acggaattac cgcgacgagg       540
     ttgaattatg agtcgggact tgtcgattat gagcaggcgc ggaagcagct tgagcgggat       600
     gtgcgcaaga acttctacaa cctcttgttg atgcagcaga accgggatct cttcgtgcag       660
     cagattgccg ctgccaagga ccgttacgat caggcgagga tcaactacca gaatggtctg       720
     gttcctgaac tgacgatgct ctcggccagg gtcgcctggg agaatttgaa gccgactctg       780
     gagtcgatgg atcttagtta cgatcaggct ctttccggtt tcaagatgac cttggggctc       840
     tcccaggata cggagctgca tctcgacggt gagatttcgg ccgatcccat cgctcttgaa       900
     gccgatccgc tgatcgatca gtaccttacc ggaaggctcg atatcaagtc gcttctgtac       960
     aatctcaaga acttggatgt acaacgtcgt gcgaccatct cccaggcctt taccccgggt      1020
     cttaccgtag gctggagcta tgatccgacc atgaacgacc cttttggcgg ggattatttc      1080
     aattcggaca gctgggacca gcaaagtggg atgttccgaa tcacggttgc gatgaatctg      1140
     gaggggtttc tgcccggcag caaaacaaag gttgagctgg ccggtataga agacgataag      1200
     aggagccttc ggctcagtct gatgcaggcg atcgagggag ccgaaatgga gattgattcg      1260
     cttgtaaaac agttgaacca ttcgaaaaac agcatggata gccttaaact taatatcgaa      1320
     ctggcagacc aagcgtatcg aatggcggag gaggcctacc gtgccggaag ccgggaactt      1380
     ttagaggtgc agaatgccga gatcgagctc aataatgcga aatacgagct gctgaaggag      1440
     aagtacaact acgtgacagg cttgttggac cttgaatatg cgttaaatac aacgctggat      1500
     aagataaagg aaggaaacga tgaatag                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page