(data stored in ACNUC7421 zone)

EMBL: CP002116.PE37

CP002116.PE37        Location/Qualifiers
FT   CDS_pept        36136..37101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0037"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="COGs: COG0845 Membrane-fusion protein; InterPro
FT                   IPR006143; KEGG: btu:BT0141 acriflavin resistance
FT                   periplasmic protein; PFAM: secretion protein HlyD family
FT                   protein; SPTR: Acriflavin resistance periplasmic protein;
FT                   TIGRFAM: efflux transporter, RND family, MFP subunit; PFAM:
FT                   Biotin-requiring enzyme; TIGRFAM: RND family efflux
FT                   transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79197"
FT                   /db_xref="GOA:E1R6R5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R5"
FT                   /protein_id="ADK79197.1"
FT                   /translation="MNRKTAGLLLMLFALLIFVTGCDKLPGRGNKENATEAGSEKDADE
FT                   NTETVFAVSVTEAVTGQIYNYLNVNGDVVSKTTVDTYPDVAGKVSRILVAVGDTVRKNQ
FT                   VVAEVDPSKPGMNYAASPVKAAITGTITSIPVEVGSMVSQQSPIVRISRMDELQIKTYV
FT                   AERFISRMKLGQQALVSLDAFPGKTFMAKVVELSPMVDASSRTMDLKLDFVGSTDGVRA
FT                   GMFAKIKIITEDKEGVVKIPSAAVIERFGEDYVFVIKDESSVERRKVTAGIEIDGKQEI
FT                   LEGLSGGETTVIRGQTLLEDGSLVKVVQKVEPLPVKDSID"
     atgaatagga aaaccgcagg gcttttgctg atgctctttg cactgctgat ctttgttacc        60
     ggatgcgata agcttcccgg tcggggaaac aaggaaaatg ctaccgaagc aggatctgag       120
     aaggatgcag acgagaacac ggaaacggtc tttgccgtga gtgttaccga agcagttacg       180
     ggccagatct acaactatct caatgtaaat ggcgatgtcg tttcaaagac gacggtcgat       240
     acctatcccg atgtagcggg aaaggtaagc aggattctgg tagcagtggg ggatacggtt       300
     cggaagaacc aggttgttgc ggaggtggat ccctcaaaac ccggtatgaa ctatgcggca       360
     agtccggtga aggctgccat tacggggaca ataaccagta ttcccgtgga agtcggttcc       420
     atggtaagcc agcagtctcc gattgtgaga atcagcagga tggatgagtt acagatcaaa       480
     acctatgttg ccgaacgctt tatcagcagg atgaagctgg ggcagcaggc tttggttagt       540
     cttgatgcct ttcccggcaa aaccttcatg gccaaggttg ttgaattgag tcccatggtg       600
     gacgcctcca gccgaaccat ggacctgaag cttgattttg tcggttctac cgatggggtg       660
     agagccggaa tgttcgctaa gatcaaaatc attaccgagg acaaggaagg ggtcgtaaaa       720
     attccttcgg cagcggttat cgaacgcttt ggtgaagact atgtctttgt aataaaagat       780
     gagtccagtg ttgaaaggcg taaggtgacg gccggtattg agatcgatgg caagcaggag       840
     atcctggaag ggctttccgg tggtgagacc accgttatca ggggccaaac acttcttgaa       900
     gacggctctt tagtgaaagt cgttcagaag gtagagcctc tgcccgttaa agattctatc       960
     gactaa                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page