(data stored in ACNUC7421 zone)

EMBL: CP002116.PE38

CP002116.PE38        Location/Qualifiers
FT   CDS_pept        37116..40325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0038"
FT                   /product="acriflavin resistance protein"
FT                   /note="COGs: COG0841 Cation/multidrug efflux pump; InterPro
FT                   IPR001036; KEGG: bdu:BDU_143 acriflavine resistance
FT                   protein; PFAM: acriflavin resistance protein; SPTR:
FT                   Acriflavine resistance protein; PFAM: AcrB/AcrD/AcrF
FT                   family; TIGRFAM: heavy metal efflux pump
FT                   (cobalt-zinc-cadmium); The (Largely Gram-negative
FT                   Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79198"
FT                   /db_xref="GOA:E1R6R6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R6"
FT                   /protein_id="ADK79198.1"
FT                   /translation="MSVSKTVVGKPTTILIIFLLLIGLGIYSTSDLAIDLYPEIEPPVL
FT                   VVFTGYDGAGPEEIEKRITRTLEGSLSNVSNIESITSTSSEGSSMIMVEFTWGTDMAEA
FT                   ANSVRDNLEFVKGALPDEADSPMIFKFDPSMIPIMGLTLSGNRTPEELRQIAEDVVQPK
FT                   IEQIEGVALTSVSGGRERIIRVEIPQDRLEAYDLTLTQISSMLQGQNVQVTAGNIDEGN
FT                   INYLVTTSGEYDSIDQIKNTVISYKNEGMPGTSGDGSTQRTVRLRDIADVYDGYKDADS
FT                   LVYINGEPGIQIIIQKQSGTNSVQTADNIRNRLERINKQVPEGITVTEIFNTTDIIKSS
FT                   LNQVSSSAITGALLAIIVLFVFLRSLKSTFIIGLTIPVSLIVTLMLMYFFGLTLNIMTL
FT                   AGLALGVGMLVDNSIVILENIYRYREKGAKLTASAILGSQEMINAIVASTLTTICVFAP
FT                   VVLFKSQLDVVGELLASLAFTVVISLSASLVVAVTLIPVLSSHYLPLTSRRQRPLRGTL
FT                   KALDGVMERFFQGLENLYASILRGVLRHKIITIVVVLAVFLSSLTLIPKTGFEFMPSMQ
FT                   EDQVNLGVELPVGTKLEITETVIKQMEDIVRSEVKGYDDIITEVGEASFFGLGGSAIGY
FT                   KGSIRIMLPPYKERIDSSDDVKQKLRKHFNDFPSAVFSFDSSQGASFGGTTPIDILIKT
FT                   EDLTKAKDIAEKIRDILQNMPEVTEPQIDLKDGLPQVEIVMDRDKMYSLGLNVYSVGQE
FT                   IQANLDGITASQFREGGNEYDIVMFLADEDRNQILDLNKVFVNNQAGQRIPLASFARYQ
FT                   KGTGPITINRENQTRVVHVTAGTVPGTALNEVADRAQQLINQEIPADEDVLIEFSGDYE
FT                   DLQKYGMRFVAIILVSVFLVFGVMASQFESFVDPFIILFAIPLSMIGVILIYFLTGQIF
FT                   NILTAVGLVMLAGIIVNNGIVLVDYTNLLRKRGMNIHDACVEAGRNRLRPILMTTLTTV
FT                   LGLVPMAFFPGEGSELVQPIGKSVVGGLSVGSLFTLLLIPVIYAIVNRVGERRQEKREA
FT                   RKLARQKNRLEIEAQCKGDEA"
     atgagcgtat caaaaaccgt cgttggcaag ccaacgacga tacttatcat tttcctgctt        60
     ttaatcggcc tcggtatcta ttccacgagt gacctggcca ttgatctcta cccggagatt       120
     gaaccacctg ttcttgttgt atttaccgga tatgacggtg cggggcccga ggaaattgag       180
     aaacggatta cccgaaccct tgaaggttct ctgtcgaacg taagcaacat cgagagtatc       240
     acctcgacga gttcggaggg gagcagcatg atcatggttg agttcacgtg ggggaccgac       300
     atggccgagg ctgcgaacag cgttagagac aacctggaat ttgtcaaagg tgcccttccc       360
     gacgaagccg acagccccat gatcttcaaa tttgatccgt caatgattcc gattatgggt       420
     ttgaccttgt cggggaacag gacccctgaa gagttacggc agattgccga ggatgtggtg       480
     cagccgaaga tcgaacagat cgaaggagtc gccctgacaa gtgtaagcgg cggacgggaa       540
     cggattatca gggttgagat cccgcaggac cgcctggagg cctatgacct tacacttacg       600
     cagatttcca gcatgttgca gggacagaat gtacaggtca ctgccggaaa tattgatgaa       660
     gggaatatca attatctggt taccaccagt ggtgaatatg acagtatcga tcagatcaag       720
     aatacggtca ttagttataa aaacgaaggt atgcccggaa caagcggaga cggttctaca       780
     cagcgtacgg ttcggctccg ggatatcgcc gatgtatacg acggctataa agatgcggac       840
     agccttgtct atataaacgg agagccgggg atacagatca tcattcagaa acagagtggt       900
     accaattccg tccagaccgc ggacaatatt cggaacaggc tcgagcgaat caataaacag       960
     gtccccgaag gaattacggt aacggagatt ttcaatacga cggatatcat taagtcgtcc      1020
     cttaatcagg tttcaagtag tgccattacc ggcgccctcc tggcgattat tgttttattt      1080
     gtctttctgc ggagcctgaa aagtaccttt atcatcggcc tgacaatccc tgtttcgctg      1140
     attgttactt tgatgctgat gtactttttc ggacttaccc ttaacattat gaccttggct      1200
     ggccttgccc ttggggttgg gatgcttgtc gataactcca tcgttattct tgaaaatatc      1260
     tatcgctacc gggagaaggg ggctaagcta acggcctccg ccatactcgg cagccaagag      1320
     atgataaacg ccatagtcgc gtctacgctg accactatct gtgtatttgc cccagtcgta      1380
     ttgttcaaga gccagcttga tgtggtcgga gagttgcttg cttctctcgc ttttaccgtt      1440
     gtcatcagcc tctccgccag tcttgtggtt gccgtgacct tgattcccgt tctttcgagc      1500
     cactaccttc cgctgacaag ccgcagacag cgccccttgc ggggaaccct caaggccctc      1560
     gacggggtaa tggagcgttt tttccaggga cttgagaatc tttacgcatc gatcctcagg      1620
     ggtgtgcttc ggcataagat tataacgatt gtcgtggtgc ttgctgtctt tctctcttcc      1680
     cttacactta ttccgaagac tggctttgaa tttatgccaa gtatgcagga ggatcaggtt      1740
     aacctgggtg tggaacttcc ggtgggaaca aagcttgaaa tcaccgaaac ggtcatcaag      1800
     cagatggaag atattgttcg cagcgaagtg aaggggtatg atgatatcat taccgaagtg      1860
     ggggaagcct ccttcttcgg cctcggcgga agtgctatcg gctataaagg gagcatcagg      1920
     atcatgctgc ctccctataa agagcgcatc gactcttccg atgatgtgaa acagaaactg      1980
     cgtaaacact tcaacgattt tccttcggcg gtattttcct tcgacagcag tcagggggca      2040
     agtttcggcg gaacaacgcc catcgatatt ctgataaaaa ccgaagattt gaccaaagca      2100
     aaggatatcg cggaaaagat tcgtgatatt ctgcaaaaca tgccggaggt gacggaacct      2160
     cagatcgatc tgaaagacgg acttcctcag gtagaaattg tcatggatcg agacaagatg      2220
     tactcccttg gccttaacgt ttactcggta ggccaggaga ttcaggcaaa tctcgacggt      2280
     attaccgcaa gccagttccg tgagggtgga aacgaatacg atatcgtcat gtttcttgcc      2340
     gatgaggata gaaatcagat tctcgatttg aataaggttt tcgtcaataa tcaggcagga      2400
     cagcgtatcc ctcttgccag ctttgccagg taccaaaagg gaaccgggcc gattaccatc      2460
     aatagagaga atcagacccg tgttgtacat gtaacagcag gaacggtacc cggaacggcc      2520
     ctgaacgagg tggccgaccg tgcccagcag ctgattaatc aggaaatccc tgccgatgag      2580
     gatgtactca ttgagttctc cggtgattat gaagatttgc aaaagtatgg catgagattt      2640
     gttgcaatca ttcttgtttc cgtgttcctc gtcttcgggg tcatggccag ccagtttgag      2700
     tcctttgtcg atccgtttat tattcttttt gcgattccgc tttctatgat cggcgttatt      2760
     ctgatctatt ttcttaccgg gcagatcttc aacatcttga cggcggtcgg tctggttatg      2820
     cttgcgggaa ttatcgtgaa caacgggatt gtactggtag attataccaa tttgctgaga      2880
     aaacgtggaa tgaatatcca cgatgcctgc gtggaggcgg ggagaaaccg actccggccg      2940
     atccttatga cgacgctgac aacggtcctc ggattggttc ccatggcctt tttccctggt      3000
     gaaggttcgg aacttgtgca gccgatcggc aaatcggtgg tgggcggtct ttcggttggc      3060
     tctcttttca ccttgcttct cattcctgtg atatatgcaa ttgttaatag ggttggtgag      3120
     cgccgtcagg aaaaacggga ggcacgtaaa cttgccagac agaagaatcg tttggaaatt      3180
     gaagcacagt gcaaaggaga tgaggcatga                                       3210
//

If you have problems or comments...

PBIL Back to PBIL home page