(data stored in ACNUC7421 zone)

EMBL: CP002116.PE384

CP002116.PE384       Location/Qualifiers
FT   CDS_pept        405193..405876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0389"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH282 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79544"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB14"
FT                   /protein_id="ADK79544.1"
FT                   /translation="MIEAILNKKIRQNKRYWEDVIFSSVFGMLKYLNKGILYDVLKNAK
FT                   TLNEKENKFYYLKDQLNFIDSDNINYEFWKHLQLKDCKRCEPDLIIEGPNSIVCIEAKY
FT                   KSGKSSKKDNSNVPNDQLAKEYDNLSYYKGKKQLYLIYLTSSLRYPIEDIKESIDEYNN
FT                   KRKLPITIYWLNWNKIYCQLDKCRHNKRIIDDICLVLEYFYLDYFTHFKISSDKEYKRI
FT                   DWRFR"
     ttgatagaag caatccttaa taaaaagatt aggcaaaaca aaagatactg ggaagatgtt        60
     attttttcat ctgtatttgg tatgcttaaa tatttgaaca agggaatcct ttatgatgta       120
     ctaaagaacg ctaaaactct aaatgagaaa gaaaataaat tttattattt aaaagatcaa       180
     cttaatttta ttgatagtga taatatcaat tatgaattct ggaaacatct acagctaaag       240
     gattgtaaaa gatgtgaacc tgatttgatt atagagggcc ccaattcaat tgtatgtatt       300
     gaagcaaagt ataaatcagg taagagtagt aaaaaagata atagtaatgt tcctaatgat       360
     caattagcaa aagaatatga taatctttca tattacaaag ggaaaaaaca actatattta       420
     atatatttaa ctagtagtct tagatatcca atagaagata taaaagaatc aatagatgaa       480
     tataataata aaagaaaatt accaataaca atatattggt taaattggaa taaaatatac       540
     tgtcaattag ataaatgcag acataataaa agaataattg atgatatttg tttagtttta       600
     gaatattttt atttagatta ctttactcat ttcaaaataa gttctgataa agaatataaa       660
     agaatagact ggaggtttag atga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page