(data stored in ACNUC7421 zone)

EMBL: CP002116.PE385

CP002116.PE385       Location/Qualifiers
FT   CDS_pept        405873..406436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcb:PC000842.02.0 structural maintenance of
FT                   chromosome protein; SPTR: Putative uncharacterized protein
FT                   PY06369"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79545"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB15"
FT                   /protein_id="ADK79545.1"
FT                   /translation="MNDVIGIVENIEQMKSILMSLKKMTKYIINDFEEKNWELLEEKYI
FT                   SDCMPNKRKANYEEQFDLLFSMPTELFHVFKYRSRNKKFFPFINIFLNSINNINQPVVI
FT                   YGKFIPKDKVKKDKYWEEFQYDASKLILNNAIEKTSGGIILVDDLTEEEKNEFYYIKKI
FT                   EYRIINLFEVDNEILSKLIKEITT"
     atgaatgatg ttataggaat tgttgagaat attgaacaga tgaaatcgat actgatgagt        60
     ttgaaaaaga tgacaaaata tataatcaat gattttgaag aaaagaattg ggagttatta       120
     gaagaaaaat atatttccga ttgtatgcca aataagagaa aagcaaatta tgaagaacaa       180
     tttgatttac tatttagtat gccaactgaa ttatttcacg tattcaaata tagaagtaga       240
     aataaaaagt tttttccatt tattaatata tttttgaata gtattaacaa tattaatcaa       300
     ccagttgtta tatatggaaa attcatacct aaagataaag ttaaaaagga taaatattgg       360
     gaagaatttc agtatgatgc ttcaaaatta atattaaata acgcaataga gaaaacaagt       420
     ggtgggataa ttctggtaga tgacttaaca gaagaagaaa agaatgaatt ttattatatt       480
     aaaaaaatag agtatagaat aattaatcta tttgaagtag ataatgaaat tctgagtaaa       540
     ttgataaaag aaataacaac ataa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page