(data stored in ACNUC7421 zone)

EMBL: CP002116.PE386

CP002116.PE386       Location/Qualifiers
FT   CDS_pept        406636..408267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0391"
FT                   /product="putative transcriptional regulator"
FT                   /note="InterPro IPR000055:IPR007421; KEGG: mac:MA3410
FT                   hypothetical protein; PFAM: AAA-4 family protein;
FT                   restriction modification system DNA specificity domain;
FT                   SPTR: Type I restriction-modification system M subunit;
FT                   PFAM: Divergent AAA domain; Type I restriction modification
FT                   DNA specificity domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79546"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB16"
FT                   /protein_id="ADK79546.1"
FT                   /translation="MEIIEKFIDEITAHLDIKKFLHINMEMSNQYHFHNSINENNYDYI
FT                   LKNNIYSFEKDELSRNYDLIFGVLPFGIKDFKQYQKYKIPVNYDVIINTLEKLEKNGLG
FT                   IYTVEPSFFWSTRGKVFIDLLEEKSYFINFCIEAPKGIIPYTNIRPYLIGLSKEKTELF
FT                   IGSLNELNNVSVLIDNYFNNKSSNNIDFGKLVDINDFTSISNEEVKKEEQILLQHYKNV
FT                   EFKVVKDIIKSITPVKDSEDFSNSENEIYITKQGNLPSKINHKNFSNLLKIDVNHNLIN
FT                   PKYLEIYFRSSLGQISLKSIQLGSSIPYIRRTDLLKIKIPVPPLIEQSDIVEVNEKLNE
FT                   LKERIASLENEFSLNLSSSKFISEKIETTLNQISHDSINDRIIHCLKTGENKNIEYKES
FT                   FSLNVKEKEKNPRKDKAIELSALKTIVGFLNSNGGYLLIGVDDNATIFGIEDELKMLFK
FT                   NNNDSYLLYIKDKIKNKIGVEFFQYINYQITDFNGTKLLFIEVDKSPLPCCYEKKDFYL
FT                   RLNPATEKLEGKELIEYIFRRFQNET"
     atggaaataa ttgaaaaatt catagatgaa ataacagctc atttagatat taagaaattt        60
     cttcatataa atatggaaat gagtaatcag taccattttc ataattcaat taatgagaat       120
     aactacgatt atattttaaa aaacaatatt tatagctttg aaaaagatga gctctcaaga       180
     aattatgatc taatatttgg agtactacca tttggtatta aggattttaa acaatatcaa       240
     aaatataaaa taccagttaa ttatgatgta ataatcaata cattggaaaa attagagaaa       300
     aatggtcttg gtatatatac cgttgaacct tctttctttt ggtctactag gggtaaagtc       360
     tttattgatc tacttgaaga gaaatcttat tttataaatt tctgtattga agcgccaaag       420
     ggaataatac catatacaaa tattcgacct tatttaatag gtcttagcaa agagaaaaca       480
     gaactgttta taggttcact taatgaactc aataatgtca gtgttttaat tgataattat       540
     tttaataata aaagttcaaa taatatagat tttggaaaac tcgtcgatat aaatgatttt       600
     acaagtatat caaatgaaga ggttaaaaaa gaggagcaga ttttacttca acattacaag       660
     aatgtagaat ttaaagtagt caaagatata attaaaagca tcacccctgt caaagattca       720
     gaggatttta gtaatagcga aaatgaaatt tatataacaa agcaaggaaa tctaccaagt       780
     aaaataaatc ataagaactt cagtaatcta ttaaagatag atgtaaatca taatttaatt       840
     aatcctaaat accttgaaat atatttcaga tctagtcttg gacagatttc attaaagtca       900
     atacaacttg gatcttcaat cccttatata agaagaactg atttacttaa aatcaagata       960
     ccagtaccac ctctcataga gcaaagtgat attgtagaag ttaatgagaa gttaaatgaa      1020
     ttaaaagaaa gaattgcaag ccttgaaaac gagttttctt taaatctatc aagttcaaaa      1080
     tttatttctg aaaaaataga gactacatta aatcaaatta gtcatgattc tataaatgac      1140
     agaattattc attgtttaaa aactggcgaa aataagaata ttgaatataa agaatcattt      1200
     tctcttaatg taaaagaaaa agagaaaaac cctagaaaag ataaagcaat tgaattatct      1260
     gcattgaaaa ctattgttgg tttcttaaat tctaatggag gctatttact tattggtgta      1320
     gatgataatg ctacaatttt tggtattgag gatgaactaa aaatgttatt caaaaataat      1380
     aatgattcct atcttctata tataaaggac aagataaaaa ataaaatagg agtagaattc      1440
     tttcaataca ttaattacca aattacagat tttaatggca ccaaattatt atttatagaa      1500
     gttgataaat ctccattgcc ttgttgctat gagaaaaagg atttttattt acgattaaat      1560
     ccagcaactg aaaaattaga agggaaagaa cttatcgaat atatatttag aaggtttcaa      1620
     aatgaaacat aa                                                          1632
//

If you have problems or comments...

PBIL Back to PBIL home page