(data stored in ACNUC7421 zone)

EMBL: CP002116.PE388

CP002116.PE388       Location/Qualifiers
FT   CDS_pept        410187..410729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0393"
FT                   /product="Domain of unknown function DUF1863"
FT                   /note="InterPro IPR015032; KEGG: sun:SUN_2116 hypothetical
FT                   protein; PFAM: Domain of unknown function DUF1863; SPTR:
FT                   Putative uncharacterized protein; PFAM: MTH538 TIR-like
FT                   domain (DUF1863)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79548"
FT                   /db_xref="InterPro:IPR015032"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB18"
FT                   /protein_id="ADK79548.1"
FT                   /translation="MSRHRVFISYHHLNDQQYKNQLEGIFRSSYEVALSNSVQIGDLNP
FT                   NLPSDRLRQLIRDKYIRDATVTIVLIGTETWKRRHVDWEIGSSIRKTEYNSRCGLIGLL
FT                   LPTRSDYYRDSFYPYTIPPRLYLNAKNGYAKIYNWTTNFMNLKYWIDEAFDRRNVIIPD
FT                   NSFPNFVNNRSGDRWYE"
     atgtcacgac atagagtatt tataagttat catcacctga acgatcaaca atataaaaat        60
     cagctcgaag gcatattcag atcatcatat gaagtcgcat tgtcaaatag tgtacaaatt       120
     ggagatttga atccaaattt accttcagac cgattacgtc aattgataag agataagtat       180
     ataagggatg ctactgttac aatagtatta attggaactg aaacttggaa aagaaggcat       240
     gtggattggg aaattggttc atcaattcgt aaaactgaat ataattctcg ctgtggatta       300
     attggtcttc ttctccctac ccgcagcgac tattacagag attcttttta tccatatact       360
     attcctccta ggctttattt gaatgcaaaa aatggatatg ccaaaattta caactggaca       420
     acaaatttca tgaatctaaa atactggata gatgaagctt tcgatagacg aaatgtaata       480
     atacctgata attcatttcc aaactttgta aataatagaa gcggagatcg atggtatgaa       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page