(data stored in ACNUC7421 zone)

EMBL: CP002116.PE39

CP002116.PE39        Location/Qualifiers
FT   CDS_pept        40322..40618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bre:BRE_141 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79199"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R7"
FT                   /protein_id="ADK79199.1"
FT                   /translation="MKLLRVEIIANRSIEEDMHDAFRKAGIVRHYTKFPVVHGVGTSGP
FT                   RRGDHVWPEENFVLTTYCEEEELDAIVDVVRELKDFFCDEGIKVFVSKAKEIL"
     atgaaattgt tacgtgttga gatcattgcc aaccgttcta tcgaagaaga tatgcatgat        60
     gcgtttcgta aggcgggaat tgtgcgtcat tatacgaaat ttcctgtggt tcatggggtc       120
     ggtacttccg gccccaggcg gggtgatcat gtttggcccg aggagaattt tgttcttacc       180
     acctattgtg aggaggaaga actcgacgct attgtcgacg tggtgcgcga attaaaggat       240
     tttttctgcg acgaagggat aaaggttttt gtttcaaagg caaaggaaat tctatga          297
//

If you have problems or comments...

PBIL Back to PBIL home page