(data stored in ACNUC7421 zone)

EMBL: CP002116.PE398

CP002116.PE398       Location/Qualifiers
FT   CDS_pept        419997..420905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0404"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce8483 hypothetical protein; SPTR:
FT                   Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79558"
FT                   /db_xref="GOA:E1RB28"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB28"
FT                   /protein_id="ADK79558.1"
FT                   /translation="MKQLKIQSRKRYKQGFHLDAIELERIYSIIKEQMSKIELGDNEKI
FT                   FNSFHIKYKNGVRKVTNELEEVVAEENFGTFLIERIEINSYISSKDEELADYRQIYMDD
FT                   DEEGISIIFEKEIGKSFFNDNNISLIINGKERDWVMVTESLINDRINLIKRNKLEILTK
FT                   PSLSFLFVIITFSLMISMFVTLYNYIAPSAYIDEIEQKWISGVITDPVEVIIKLEKEKY
FT                   AKEFGVSVISYIPAIIGGSIAVLLLIIKVVVKKLYPVCVFYWGDYIKYFDKIDGIRKTI
FT                   VTVIIIGFLISLAAGLIVKYI"
     atgaaacagt taaagataca atcacgaaag cgctataaac aaggttttca tcttgatgca        60
     atagagttgg aaagaattta ctctatcatt aaagaacaaa tgagcaagat tgagttggga       120
     gataatgaga aaatatttaa ttcttttcat ataaaatata aaaatggtgt tagaaaagtt       180
     acaaatgaat tagaagaagt tgtagctgaa gaaaattttg gtacatttct tattgaaaga       240
     attgaaatta attcatatat atcaagcaag gatgaagaat tagctgatta tagacaaatc       300
     tatatggatg acgatgaaga aggaatttca ataattttcg aaaaagaaat aggtaaaagc       360
     tttttcaatg ataataatat aagtttgatt ataaatggaa aagaacgtga ctgggtgatg       420
     gtaacagaat cattaattaa tgacaggata aatttaataa aaagaaataa attagaaatt       480
     cttaccaaac caagcttgag ttttctattc gtcataataa cattctcttt aatgatttct       540
     atgtttgtaa cattatataa ttatatcgcg ccttcagcgt atatagatga aatagaacaa       600
     aaatggatct ctggagttat aacagacccg gttgaagtaa ttattaaact agaaaaagaa       660
     aaatatgcta aagaatttgg tgtgtcagtt ataagttata tacctgcaat tatcggagga       720
     tcgatagctg ttttgttatt gattattaaa gtcgtagtca aaaaattata tcctgtttgt       780
     gttttttact ggggtgatta cataaaatac tttgataaaa ttgatggaat tagaaaaact       840
     attgttactg taataattat tgggttttta atatcattag ctgctggtct tattgtgaaa       900
     tatatttga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page