(data stored in ACNUC7421 zone)

EMBL: CP002116.PE4

CP002116.PE4         Location/Qualifiers
FT   CDS_pept        2880..3956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="COGs: COG1195 Recombinational DNA repair ATPase
FT                   (RecF pathway); InterPro IPR001238:IPR003395:IPR018078;
FT                   KEGG: tde:TDE0230 DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; SPTR: DNA replication and repair
FT                   protein recF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: RecF/RecN/SMC N terminal domain; TIGRFAM: recF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79164"
FT                   /db_xref="GOA:E1R6N2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N2"
FT                   /protein_id="ADK79164.1"
FT                   /translation="MGFLALKTYQYRNLKDAEVCLDAPRVFLVGENGQGKSNLLEAIYL
FT                   LSFGSSFRTRRDQELIRRGCGELALHGKTAEHDISFLLSGKNGTTKSIKLDGKPVTDRK
FT                   ELVRIFPAIVFCHDDISFVNGSPERRRWFFDQTMSLHEPLFIDTLRSYRKILKLRNMAL
FT                   KEDRRDLLDVYDIQLARAGMEIQEKRREAIEGFNTTFSSLHEKVSGLEGEMKIAYRPSW
FT                   KGCKGEEDVGVLLHRRRESDLEMKTSGSGPHRDRFAFLLEGRDFSSIASTGQLRLLSLL
FT                   LRVGQARFFYEKCGRRPVLLLDDVLLELDPRRRQRFLGTLPEADQIFFTFLPDRQYSEL
FT                   KGNDTMLLRVKEGEFIEE"
     atggggtttt tagccctgaa gacatatcaa tatagaaacc taaaagacgc ggaggtgtgc        60
     cttgacgcac cccgcgtttt tcttgtgggg gagaatggcc agggaaagag taatctgctc       120
     gaggctattt atctattgag ttttggttct tcttttagaa caaggcgaga tcaggagctt       180
     attcgccggg gatgcggtga acttgcgctt catggaaaaa ccgccgagca tgatatatcc       240
     tttttgcttt caggcaagaa cggaacaaca aaaagcatta agcttgatgg aaagcctgtt       300
     accgatcgaa aagagcttgt acgtatcttt ccggccattg ttttttgtca cgacgatatc       360
     tcatttgtaa acggatcgcc ggaaagaagg cgctggtttt tcgaccaaac aatgagtctt       420
     catgaaccgc tttttatcga cacccttcga tcctatcgca aaattttgaa attacgaaat       480
     atggccttga aagaagatcg cagagatctc cttgatgttt acgatataca gttggcaagg       540
     gccgggatgg agatccagga aaagcgaaga gaggcaatag aaggctttaa tacaacattt       600
     tcttcactcc atgagaaggt ttcgggtctg gagggggaaa tgaagattgc ctatcgtccc       660
     agttggaagg gatgtaaagg cgaggaagat gttggtgttc ttcttcatcg aaggagggag       720
     agtgatttag aaatgaagac ctccggatcc ggtcctcatc gagatcgttt tgcctttctt       780
     cttgagggga gggatttttc ttccattgct tccaccggtc aacttcgact tctttccctg       840
     cttcttaggg ttggacaggc ccgatttttc tatgagaagt gtggaagacg gccggtactg       900
     ctacttgatg atgtactttt ggagcttgat ccgagacgaa ggcagcgctt tttgggaaca       960
     cttccggaag ccgatcagat tttttttacc tttcttcccg ataggcagta ttctgaactg      1020
     aagggaaacg ataccatgct tttacgggtg aaagagggtg agtttattga agaatag         1077
//

If you have problems or comments...

PBIL Back to PBIL home page