(data stored in ACNUC7421 zone)

EMBL: CP002116.PE40

CP002116.PE40        Location/Qualifiers
FT   CDS_pept        40681..41802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0040"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG3437 Response regulator containing a
FT                   CheY-like receiver domain and an HD-GYP domain; InterPro
FT                   IPR003018:IPR003607:IPR006674; KEGG: wsu:WS1630 response
FT                   regulator; PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; GAF domain protein; SMART: GAF domain protein;
FT                   metal-dependent phosphohydrolase HD region; SPTR: Metal
FT                   dependent phosphohydrolase; PFAM: HD domain; GAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79200"
FT                   /db_xref="GOA:E1R6R8"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R8"
FT                   /protein_id="ADK79200.1"
FT                   /translation="MKNTELRKEPSAQELLKIIFKYINLIANERDVGRLLVALADMGRD
FT                   LITADRCTVWLVNQQRGELWSKIAHGVDRIVIPLSKGVAGYVATTGKSMITNDAYADER
FT                   FDKQVDSETGYRTRNIIALPIRDSAGEVMGVYQAINKMSGEDGFTERDLEHLQLAASYT
FT                   GSELEAVALQEEIEQTQREMIVTLAEAGEMRSKETGGHVRRVAEYSYLIALAMGMDAEE
FT                   AELLKNASPMHDIGKIAIPDAILLKEGPLTDEEREVMKTHTTIGYDMLKYSTRDLLKTS
FT                   AIVAYQHHEKWDGSGYPQGLVGEDIHIYARITAIADVFDALSCDRVYKAAWPKEKIVAL
FT                   FKAERGHHFDPVLCDIMDGLWDQLYAIKRQYSH"
     atgaagaaca cagagctccg taaggagcct tccgcccagg aactcttgaa gatcattttt        60
     aaatatataa acctcattgc aaatgaacgg gatgttggtc gtctgcttgt cgccctggct       120
     gatatgggtc gggatcttat tacggccgat cgctgtaccg tttggctggt caaccagcag       180
     cggggagagt tgtggagtaa gattgctcat ggggtcgacc gtattgttat ccccctttca       240
     aagggggttg ccggttatgt agccactacc ggaaagagta tgatcaccaa cgatgcctat       300
     gcggatgagc gtttcgacaa gcaggtcgat agcgaaaccg gttatcgaac cagaaatatc       360
     attgcacttc cgattcgtga ttcggccgga gaggtaatgg gggtctacca ggcgatcaat       420
     aaaatgtccg gggaggatgg ctttaccgaa cgggatttgg aacacctgca gcttgctgca       480
     agctataccg gcagtgaact cgaagccgtt gctcttcagg aagaaattga gcaaacccag       540
     cgggagatga tcgttaccct tgcagaagcg ggtgaaatgc gttcgaagga gacaggcggg       600
     catgtcaggc gggtcgccga atactcctac cttattgctc tggccatggg aatggatgca       660
     gaggaggccg aactattaaa aaatgcctct cccatgcatg atataggcaa gattgccatt       720
     cccgatgcca tcttgttgaa agaggggccg cttaccgatg aagaacggga ggtgatgaag       780
     acccacacca caattggtta tgatatgcta aagtattcga caagagatct tctaaaaaca       840
     tcggcgattg ttgcgtatca gcaccacgaa aaatgggacg gcagcggtta tcctcaaggc       900
     cttgttggag aggatatcca tatctacgct aggattaccg ccattgccga tgtatttgac       960
     gccctttcct gcgacagggt ctacaaagcg gcctggccca aagaaaagat tgttgcattg      1020
     ttcaaagcgg aacggggaca ccacttcgat cctgtccttt gcgatattat ggatgggttg      1080
     tgggatcagt tgtacgcaat caagaggcag tattctcact aa                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page